KEGG   Acidovorax ebreus: Dtpsy_2558Help
Entry
Dtpsy_2558        CDS       T00853                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dia  Acidovorax ebreus
Pathway
dia00260  Glycine, serine and threonine metabolism
dia00750  Vitamin B6 metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01230  Biosynthesis of amino acids
Module
dia_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtpsy_2558
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dtpsy_2558
Enzymes [BR:dia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dtpsy_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACM33993
UniProt: B9MDI4
Position
complement(2720604..2722034)
Genome map
AA seq 476 aa AA seqDB search
MLYLSTRGHADRKHFCDILLEGLAPDGGLYLPERYPQISDAELTALRTAYHTQGYAELAF
RILSLYIDDIPPADLKRLCEKTYTAEVFGTGEIVPLRHLEDGLWIEALSNGPTLAFKDMA
MQLLGNLFEYELARRGEQLNILGATSGDTGSAAEYAMRGKQGVRVFMTSPHGRMSPFQQA
QMFSLQDANIHNLAIEGVFDDCQDIVKAVSNDHAFKAQYKIGTVNSINWARLLAQVVYYF
AGYIQATETNGQKVSFTVPSGNFGNICAGHVARQMGLPIDRLIVATNENDVLDEFFRTGA
YRVRGAADTHETSSPSMDISKASNFERFVFDLLGRNAERTRELFAEGVAKQGFFDLGSDP
VFRDARAKYGFESGKSTHADRLATIRDTYERFGQIIDTHTADGVKVAREHRGDPAVPMIV
LETALPIKFAETIQEALGRAPERPARFEGIEQLPKRLQVLAADAEQVKAYIAAHCD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacctgtccacccgcggccacgcggaccgcaagcatttctgcgacatcctgctc
gaaggcctggcgcccgacggcggcctgtacctgcccgagcgctacccgcagatcagcgac
gccgagctgaccgcgctgcgtaccgcctatcacacgcaaggctatgccgaactggccttc
cgcatcctgtcgctgtacatcgacgacatcccgcccgcggacctgaagcgcctgtgcgag
aagacgtacaccgccgaagtgttcggcacgggcgagatcgtgccgctgcgccacctggaa
gacggcctgtggatcgaggccctgtccaacggccccacgctggccttcaaggacatggcc
atgcaactgctgggcaacctgttcgagtacgagctggcccgccgtggcgagcagctcaac
atcctgggcgccaccagcggcgacaccggcagcgcggccgagtacgccatgcgcggcaag
cagggcgtgcgcgtgttcatgaccagcccgcacggtcgcatgagcccgttccagcaagcg
cagatgttcagcctgcaggacgcgaacatccacaacctggccatcgaaggcgtattcgac
gactgccaggacatcgtcaaggcggtgagcaacgaccacgcgttcaaggcccaatacaag
atcggcaccgtcaactcgatcaactgggcgcgcctgctggcgcaggtggtgtactacttc
gcgggctacatccaggcgacggagacgaacggccaaaaggtcagcttcaccgtgcccagc
ggcaacttcggcaacatctgcgccgggcacgtggcgcgccagatgggcctgccgatcgac
cgcctgatcgttgccaccaacgaaaacgacgtgctcgacgagttcttccgcaccggcgcc
taccgcgtgcgcggcgcggccgacacgcacgagaccagcagccccagcatggacatcagc
aaggccagcaacttcgagcgtttcgtgttcgacctgctggggcgcaatgcggagcgcacg
cgcgagctgttcgccgagggcgtggccaaacagggcttcttcgacctggggagcgacccc
gtgttccgagacgcacgcgccaagtacggcttcgagagcggcaagagcacgcacgccgac
cgcctggccaccatccgcgacacgtacgagcgcttcggccagatcatcgatacccacacc
gccgacggcgtgaaggtggcgcgcgagcaccgtggcgatcccgctgtgcccatgatcgtg
ctggagacggccctgcccatcaagtttgccgaaaccatccaggaagccctgggccgcgca
cccgagcgcccggccaggttcgagggcatcgagcaattgcccaagcgcctgcaggtgctg
gcggccgatgccgagcaggtcaaggcctatatcgcagcccattgcgattag

DBGET integrated database retrieval system