KEGG   Acidovorax ebreus: Dtpsy_2592Help
Entry
Dtpsy_2592        CDS       T00853                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dia  Acidovorax ebreus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtpsy_2592
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtpsy_2592
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtpsy_2592
Enzymes [BR:dia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dtpsy_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2755222..2756490
Genome map
AA seq 422 aa AA seqDB search
MPAYTQPDASGHFGPYGGSFVSETLTHAINELREAYARYQNDPEFLKEFHYELAHFVGRP
SPVYHAARTSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRIIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGKECLTQMPAMLAEQKIAAEQPDAVVA
CVGGGSNAMGIFHTYIPFEKTRLIGVEAAGEGLDSGKHSASLQRGSSGVLHGNRTFILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIKRAEYVGITDTEALEAFHYLCRTEGIIPAL
ESSHAVAYALKLAKTMTPQQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGLTVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcatatacccaacccgatgcttcgggccattttggcccctatggcggcagcttc
gtctccgagacgctgacgcacgccatcaatgaactgcgcgaagcctatgcgcgctaccag
aacgacccggagtttctcaaggaattccactatgagcttgcgcacttcgtgggccgcccc
tcgccggtttaccacgcggcgcgcaccagccgcgagatgggcggcgcgcagatctacctc
aagcgcgaagacctgaaccacaccggcgcacacaagatcaacaacgtgatcggccaggcc
atgctcgccaagcgcatgggcaagccgcgcatcattgccgagaccggcgccggccagcac
ggcgtggccaccgccaccatctgcgcgcgctatggcctggagtgtgtggtgtacatgggc
gccgaggacgtcaagcgccaaagtcccaacgtctaccgcatgaagctgctgggcgccacc
gtggtgcccgtcgagtcgggcagcaagacgctgaaagatgcgctcaacgaggccatgcgc
gactgggtggccaacgtggacaacaccttctacatcatcggcaccgtggccggcccccac
ccctatcccatgatggtgcgtgacttccaaagcgtgatcggcaaggaatgcctcacgcag
atgcccgccatgctggccgaacagaagatcgccgccgagcaacccgacgccgtcgtggcc
tgcgtgggcggtggcagcaatgccatgggcatcttccacacctacatcccgttcgagaaa
acccgcctgatcggcgtggaagccgcaggcgaaggcctggacagcggcaagcattccgcc
agcctgcagcgcggctccagtggcgtgctgcacggcaaccgcaccttcatcctgcaagat
gagaatggccagatcactgagacgcacagcatcagcgccggcctggactaccccggagtg
ggccccgagcacgcctggctgcaggaaatcaagcgagccgagtacgtgggcatcaccgat
acggaagcgttggaagcctttcactacctgtgccgcaccgagggcatcatcccggccctg
gaatccagccacgccgtggcctacgcgctcaagctcgccaagaccatgacgccccagcaa
tccatccttgtgaacctgtccggccgcggcgacaaggacatcggcaccgtggccgacctg
tctggcgtggacttctacgaccgtccttccatgcgcgggttgaccgtcaagggaggaccc
gccgcatga

DBGET integrated database retrieval system