KEGG   Acidovorax ebreus: Dtpsy_2592Help
Entry
Dtpsy_2592        CDS       T00853                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dia  Acidovorax ebreus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtpsy_2592
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtpsy_2592
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtpsy_2592
Enzymes [BR:dia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dtpsy_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2755222..2756490
Genome map
AA seq 422 aa AA seqDB search
MPAYTQPDASGHFGPYGGSFVSETLTHAINELREAYARYQNDPEFLKEFHYELAHFVGRP
SPVYHAARTSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRIIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGKECLTQMPAMLAEQKIAAEQPDAVVA
CVGGGSNAMGIFHTYIPFEKTRLIGVEAAGEGLDSGKHSASLQRGSSGVLHGNRTFILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIKRAEYVGITDTEALEAFHYLCRTEGIIPAL
ESSHAVAYALKLAKTMTPQQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGLTVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcatatacccaacccgatgcttcgggccattttggcccctatggcggcagcttc
gtctccgagacgctgacgcacgccatcaatgaactgcgcgaagcctatgcgcgctaccag
aacgacccggagtttctcaaggaattccactatgagcttgcgcacttcgtgggccgcccc
tcgccggtttaccacgcggcgcgcaccagccgcgagatgggcggcgcgcagatctacctc
aagcgcgaagacctgaaccacaccggcgcacacaagatcaacaacgtgatcggccaggcc
atgctcgccaagcgcatgggcaagccgcgcatcattgccgagaccggcgccggccagcac
ggcgtggccaccgccaccatctgcgcgcgctatggcctggagtgtgtggtgtacatgggc
gccgaggacgtcaagcgccaaagtcccaacgtctaccgcatgaagctgctgggcgccacc
gtggtgcccgtcgagtcgggcagcaagacgctgaaagatgcgctcaacgaggccatgcgc
gactgggtggccaacgtggacaacaccttctacatcatcggcaccgtggccggcccccac
ccctatcccatgatggtgcgtgacttccaaagcgtgatcggcaaggaatgcctcacgcag
atgcccgccatgctggccgaacagaagatcgccgccgagcaacccgacgccgtcgtggcc
tgcgtgggcggtggcagcaatgccatgggcatcttccacacctacatcccgttcgagaaa
acccgcctgatcggcgtggaagccgcaggcgaaggcctggacagcggcaagcattccgcc
agcctgcagcgcggctccagtggcgtgctgcacggcaaccgcaccttcatcctgcaagat
gagaatggccagatcactgagacgcacagcatcagcgccggcctggactaccccggagtg
ggccccgagcacgcctggctgcaggaaatcaagcgagccgagtacgtgggcatcaccgat
acggaagcgttggaagcctttcactacctgtgccgcaccgagggcatcatcccggccctg
gaatccagccacgccgtggcctacgcgctcaagctcgccaagaccatgacgccccagcaa
tccatccttgtgaacctgtccggccgcggcgacaaggacatcggcaccgtggccgacctg
tctggcgtggacttctacgaccgtccttccatgcgcgggttgaccgtcaagggaggaccc
gccgcatga

DBGET integrated database retrieval system