KEGG   Acidovorax ebreus: Dtpsy_2613Help
Entry
Dtpsy_2613        CDS       T00853                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dia  Acidovorax ebreus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtpsy_2613
   01230 Biosynthesis of amino acids
    Dtpsy_2613
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_2613
   00030 Pentose phosphate pathway
    Dtpsy_2613
   00051 Fructose and mannose metabolism
    Dtpsy_2613
   00052 Galactose metabolism
    Dtpsy_2613
  Energy metabolism
   00680 Methane metabolism
    Dtpsy_2613
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dtpsy_2613
Protein phosphatases and associated proteins [BR:dia01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dtpsy_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2775953..2777005)
Genome map
AA seq 350 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVTKSLIHHGHCEVLGIEDGFEGLRGEASRARLLTWDQVS
GIVHMGGTILGTSNSANPLKDDATLAQVERNVRALGLDVVVAIGGDGTMSLAHGLARIGL
QCVGVPKTIDNDIALCERSFGFDTAVATATDAMRRIESTAYSHHRVMIVETMGRHAGWLA
LESGIAAAADVILLPEIDYDLQPIIERCRRREQRQRYTVICIGEGAKERGAGLTVREQVA
HSPDPVRLGGVGHVLRQRLQPHLQSEVRTTVLGHVQRGGDPTAFDRVLATRFGHRAAQLV
IDGQFGHMVTLQGGHIASVPIAQVANTQRKVPLDHELIAIARAIDVCLGE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcggcgtactcaccggcgggggcgactgcccggggctgaacgcggtgatccgc
gcggtcaccaagtcgctgatccaccacggacactgcgaggtactgggcatcgaagacggc
ttcgagggcctgaggggcgaagcgtcgcgcgcgcggctgctcacctgggaccaggtctcg
ggcatcgtgcacatgggcggcaccatcctgggcacgagcaacagcgccaacccgctgaag
gacgacgcgacgctggcccaggtggagcgcaacgtgcgcgcgctgggcctggacgtggtg
gtggccattggcggcgacggcaccatgagcctggcccatggcctggcgcggatcgggctg
caatgcgtgggtgtgcccaagaccatcgacaacgacatcgcgctgtgcgagcgcagcttc
ggctttgacaccgccgtggccacggccaccgacgcgatgcgccgcatcgagagcacggct
tacagccaccaccgcgtcatgatcgtcgagaccatgggccgccatgcgggctggctggcc
ctggaaagcggcattgccgccgcggccgacgtgatcctgctgcccgagatcgactacgac
ctgcagcccatcatcgagcgctgccgtcggcgcgagcagcgccagcgttacaccgtcatc
tgcatcggcgaaggcgccaaggagcgcggcgccggcctcacggtgcgcgagcaggtggcc
cacagccccgaccctgtgcgcctgggtggcgtgggccatgtgctgcgccagcggctgcag
ccgcacctgcaaagcgaggtgcgcaccaccgtgctgggccatgtgcagcgcgggggcgac
ccgaccgcgttcgatcgtgtgctggccacgcgcttcggtcaccgggcggcgcaactggtg
atcgatggccagttcggccacatggtcacgctacagggcgggcacatcgccagtgtcccc
atcgcccaggtggccaacacccagcgcaaggtgccgctcgaccatgaactgatcgccatc
gcgcgggcgatcgacgtgtgcctgggggagtag

DBGET integrated database retrieval system