KEGG   Acidovorax ebreus: Dtpsy_2905Help
Entry
Dtpsy_2905        CDS       T00853                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
dia  Acidovorax ebreus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dia00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dia00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dia02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3090858..3092678
Genome map
AA seq 606 aa AA seqDB search
MKPSSLAASLGGFITFHPPAMQRHDDSKPLTNLLQAAHASTPLAADGGRRRFVRQITLGA
AALGTLPLAACGGGDDDAPAVQFAHGVASGDPLADRVMLWTRVTPPADFSAEIPVQWEVA
SDAAFASIVARGEVRTSATRDYTVKVDATGLKPATAYHYRFKAFEATSPTGRTRTLPTGS
VAQVKLAVFSCANYPAGYFNVYADAARRGDLDATVHLGDYLYEYGQGGYASGNAAALSRL
SQPANEILSLADYRTRHAQYRTDADLQALHAAAPMIAVWDDHEIANDTWMNGAENHQAAE
GSFAARKAVALQAYHEWMPTRNAQPDVIYRSFAFGNLLALHMLDTRVVGRDAQVDYAAFF
KPGGFDAAGFTAAVGNPARQLLGTAQTQWLQQQMAASSATWQMLGQQVLMGRMNIPAPIL
METLQPGSGVTVSRYAAIVAKARTAPATLTPEEQAILAQPSIPYNLDAWDGYQAARETVL
GMARAMNKNLVVLAGDTHNAWASELNDMNGNPVGVEFATSSVSSPGFEEYLPNENPATLS
AALLQLVEPLKYCDTARRGYMVVTATATECRAQWVYVNTITSRQFTTSAETTLAVQAGTP
GRLLKV
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgtcatcccttgctgcgagccttggcgggttcatcacctttcacccgcccgcc
atgcagcgacacgacgattccaaacccctcaccaacctcctgcaggctgcgcacgccagc
accccgctagccgcagacggcgggcgccgtcgtttcgtgcggcagatcacgctgggcgcc
gccgcgctgggcaccctgcccctggcggcctgtggcggcggcgacgatgacgcacccgcc
gtacagttcgcgcacggcgtggccagcggcgacccgctggccgaccgcgtcatgctctgg
acgcgcgtcacgccgcccgccgacttcagtgccgagatccccgtgcagtgggaggtggcc
agcgacgccgccttcgccagcatcgtggcgcgcggcgaggtgcgcaccagcgccacgcgc
gactacacggtcaaggtggacgccacgggcctgaagcccgccaccgcctaccactaccgc
ttcaaggctttcgaggccacctcgcccacgggacgcacccgcaccctgcccacgggcagc
gtggcccaggtgaagctggcggtgttctcgtgcgccaactacccggccggctacttcaac
gtgtacgccgatgccgcccggcgcggcgacctggacgccaccgtgcacctgggcgactac
ctctacgaatacggccagggcggctacgcctcgggcaacgcggcggcgctgagccgcctg
tcccagccggccaacgagatcctgagcctggccgactaccgcacgcgccatgcccagtac
cggaccgatgccgacctgcaggcgctgcacgccgccgcgcccatgatcgccgtgtgggac
gaccacgagatcgccaacgacacctggatgaacggcgcggaaaaccaccaagccgccgaa
ggcagcttcgccgcgcgcaaggccgtggcgctgcaggcgtaccacgagtggatgcccaca
cgcaacgcgcagccggacgtcatttaccgcagcttcgccttcggcaacctgctggcgctg
cacatgctggacacgcgcgtggtgggacgcgatgcgcaggtcgactacgccgccttcttc
aagcccggcggcttcgacgcagcgggcttcaccgcggccgtcggcaatcccgcgcgccag
ttgctgggcaccgcgcagacgcaatggctgcagcagcagatggccgcctccagcgccacc
tggcagatgctgggccagcaggtgctgatgggccgcatgaacatccccgcgcccatcctc
atggaaacgctgcagccaggcagcggcgtgacggtgtcgcgctacgcggccatcgtcgcc
aaggcgcgcacggcgcccgccacgctcacgccggaggagcaagccatcctggcgcagccc
tccatcccctacaacctggacgcgtgggacggctaccaggccgcccgcgagacggtgctg
ggcatggcccgcgccatgaacaagaacctggtggtgctggcgggcgacacgcacaacgcc
tgggccagcgagctgaacgacatgaacggcaaccccgtgggcgtggagttcgccacctcg
tcggtgagctcgcccggcttcgaggaatacctgcccaatgaaaacccggccacgctgtcg
gcggcgttgctgcagctggtggagccactcaagtactgcgacaccgcgcgccgcggctac
atggtggtgaccgccacggccaccgaatgccgcgcgcagtgggtgtacgtgaacaccatt
accagccgccagttcaccaccagcgccgagaccacgctggccgtacaggccggcacgccg
ggccgcctgctgaaggtgtga

DBGET integrated database retrieval system