KEGG   Acidovorax ebreus: Dtpsy_2931Help
Entry
Dtpsy_2931        CDS       T00853                                 

Definition
thioredoxin, conserved site
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dia  Acidovorax ebreus
Brite
Enzymes [BR:dia01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dtpsy_2931
Secretion system [BR:dia02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Dtpsy_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3115332..3116042
Genome map
AA seq 236 aa AA seqDB search
MKLLPTLLAATALFLGLNASAQDAAIRKALAERIPQLQQIDEVRSTPMKGLYEVRIGTDL
FYTDAQGNYLIQGELIDTKARRNLTEDRINKLTAVDFKALPLQDAFTLVRGNGERKLAVF
EDPNCGYCKRFEKDMQNVDNVTVYLFLYPILSPDSAEKSRNIWCAKDRAAAWDDHMLRDK
TPAAASCDTAALQRNLAFGRKHKITGTPTLIFADGSRVPGAIGAQDVEKRLAAAGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcctccccaccttgctggccgccactgccctgttcctgggcctgaacgcatcg
gcacaggacgcagcgatccgcaaggcgctggccgagcgcatcccgcagctgcagcagatc
gacgaagtgcgctccacgcccatgaaggggctgtacgaggtgcgcatcggcaccgacctg
ttctacaccgacgcccagggcaactacctgatccagggcgagctgatcgacaccaaggcg
cggcgcaacctgacagaggaccgcattaacaagctgacggcggtggacttcaaggccctg
ccgctgcaggacgccttcaccctggtgcgtggcaacggcgagcgcaagctggcggtgttc
gaggacccgaactgcggctactgcaagcgcttcgagaaggacatgcagaacgtggacaac
gtgacggtgtacctgttcctctaccccatcctcagccccgactcggccgagaagtcgcgc
aacatctggtgcgccaaggaccgcgcggccgcgtgggacgaccacatgctgcgcgacaag
acgcccgcagcggccagctgcgacacggcagcgctgcagcgcaacctggcgttcgggcgc
aagcacaagatcaccggcacgcccacgctgatctttgccgacggctcgcgcgtgcccggc
gccatcggcgcgcaggacgtggaaaagcgcctggccgctgccgggaagtaa

DBGET integrated database retrieval system