KEGG   Acidovorax ebreus: Dtpsy_2931Help
Entry
Dtpsy_2931        CDS       T00853                                 

Definition
thioredoxin, conserved site
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dia  Acidovorax ebreus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3115332..3116042
Genome map
AA seq 236 aa AA seqDB search
MKLLPTLLAATALFLGLNASAQDAAIRKALAERIPQLQQIDEVRSTPMKGLYEVRIGTDL
FYTDAQGNYLIQGELIDTKARRNLTEDRINKLTAVDFKALPLQDAFTLVRGNGERKLAVF
EDPNCGYCKRFEKDMQNVDNVTVYLFLYPILSPDSAEKSRNIWCAKDRAAAWDDHMLRDK
TPAAASCDTAALQRNLAFGRKHKITGTPTLIFADGSRVPGAIGAQDVEKRLAAAGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcctccccaccttgctggccgccactgccctgttcctgggcctgaacgcatcg
gcacaggacgcagcgatccgcaaggcgctggccgagcgcatcccgcagctgcagcagatc
gacgaagtgcgctccacgcccatgaaggggctgtacgaggtgcgcatcggcaccgacctg
ttctacaccgacgcccagggcaactacctgatccagggcgagctgatcgacaccaaggcg
cggcgcaacctgacagaggaccgcattaacaagctgacggcggtggacttcaaggccctg
ccgctgcaggacgccttcaccctggtgcgtggcaacggcgagcgcaagctggcggtgttc
gaggacccgaactgcggctactgcaagcgcttcgagaaggacatgcagaacgtggacaac
gtgacggtgtacctgttcctctaccccatcctcagccccgactcggccgagaagtcgcgc
aacatctggtgcgccaaggaccgcgcggccgcgtgggacgaccacatgctgcgcgacaag
acgcccgcagcggccagctgcgacacggcagcgctgcagcgcaacctggcgttcgggcgc
aagcacaagatcaccggcacgcccacgctgatctttgccgacggctcgcgcgtgcccggc
gccatcggcgcgcaggacgtggaaaagcgcctggccgctgccgggaagtaa

DBGET integrated database retrieval system