KEGG   Acidovorax ebreus: Dtpsy_2961Help
Entry
Dtpsy_2961        CDS       T00853                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
dia  Acidovorax ebreus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dtpsy_2961
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dtpsy_2961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3151046..3151387)
Genome map
AA seq 113 aa AA seqDB search
MAPDAAQLARGQQIYARCAGCHAIEGHRTGPQHCGLFGRRAGTAPGFVGYSPAMKASGIV
WDERTLQRFLMDPPATVPGTSMGYTGVKDDGERAALIAWLRQATRPGSACTPR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctgacgcagcgcagctggcgcgcggtcagcagatctacgcgcgctgcgcgggg
tgccacgccatcgagggccaccgcacgggaccgcagcactgcggcctgttcggccgccgc
gcgggcacggcgccggggttcgtcggctactccccggccatgaaggccagcggcatcgtc
tgggacgagcgcacgctgcagcgcttcctgatggacccgccagccaccgtgccgggcacg
tccatgggctacacgggcgtgaaggacgatggcgagcgtgcggcgctcatcgcctggctg
cgccaggccacgcggccggggagcgcctgcacgcccaggtag

DBGET integrated database retrieval system