KEGG   Acidovorax ebreus: Dtpsy_3140Help
Entry
Dtpsy_3140        CDS       T00853                                 

Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
dia  Acidovorax ebreus
Pathway
dia00564  Glycerophospholipid metabolism
dia00565  Ether lipid metabolism
dia00590  Arachidonic acid metabolism
dia00592  alpha-Linolenic acid metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dtpsy_3140
   00565 Ether lipid metabolism
    Dtpsy_3140
   00590 Arachidonic acid metabolism
    Dtpsy_3140
   00591 Linoleic acid metabolism
    Dtpsy_3140
   00592 alpha-Linolenic acid metabolism
    Dtpsy_3140
Enzymes [BR:dia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Dtpsy_3140
    3.1.1.32  phospholipase A1
     Dtpsy_3140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ACM34573
UniProt: B9MGH8
Position
3357935..3359116
Genome map
AA seq 393 aa AA seqDB search
MTQPSHPLSRLGLATALLGTALPLVSLAETAAAPAVNRVAGWRQCAALTGDSQARLACFD
QWSAEQSWQAPPASASAQPAAATQAPPPPVDATLPATRIIDVAQVDGCRDGQYSTLSRFW
ELETGSDCGSFRFRGYRPMSVSVVGATSVNRLPTSGSPDNNAASEVDYRKTEMRVQLSVR
TKLAQGLLTRGHPTLRDSLWAGYTQQSYWQLFSPGISRPFRNTDHEPEIMYVYPTDAKLP
FGWRWRYSGIGLVHQSNGQSLPLSRSWNRVYLMTGMELDNRWTVTGRLWKRLHESADSDD
NPGISNYVGRAELGLTWNVDKDNTLALTARHSLGATGRGSARLEWLQTLGTSLVGNRTNL
RLHTQLFTGYGDSLIDYNRKRTVFSVGLSLVDF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccttcacaccccctgtcccgcctgggcctggccaccgcgctgctgggcacg
gccctgccgctggtcagcctggccgagaccgccgcagcacccgccgtcaaccgggtggcc
ggctggcgccagtgcgccgccctcaccggtgacagccaggcacgcctggcctgctttgac
cagtggtccgccgagcagagctggcaggcgccgcccgcttcggccagcgcccagcccgcc
gccgccacgcaggcgccgcccccgccggtggacgccacgctgccggccacgcgcatcatc
gacgtggcgcaggtggacggctgccgcgacggccagtacagcaccctgtcgcgcttctgg
gaactggagacgggcagcgactgcgggtcgttccgctttcgcgggtaccggcccatgagc
gtgtccgtcgtgggcgccaccagcgtcaaccgcctgcccacctcgggcagcccggacaac
aacgccgccagcgaggtggactaccgcaagaccgagatgcgcgtgcagctgtcggtgcgt
accaagctcgcgcagggcctgctcacgcgcggccaccccacgctgcgcgactcgctgtgg
gcgggctacacgcagcagtcgtactggcaactgttctcgccgggcatctcgcggccgttc
cgcaacacggaccacgagcccgagatcatgtacgtgtaccccaccgacgctaagctgccc
ttcggctggcgctggcgctacagcggcatcggcctggtgcaccagtccaacggccagagc
ctgccgctgtcgcgcagctggaaccgcgtgtacctgatgaccggcatggaactggacaac
cgctggaccgtcaccggccgtctgtggaagcgcctgcacgagagcgcggacagcgacgac
aaccccggcatcagcaactacgtgggccgggccgagctgggcctgacctggaacgtggac
aaggacaacaccctggcgctgaccgcacggcattcgctgggggcgaccgggcgcggctcg
gcacggctggaatggctgcaaaccctcggaaccagcctggtgggcaaccgtaccaacctg
cgcctgcacacccagctgttcacgggctacggcgacagcctgatcgactacaaccgcaag
cgcaccgtgttcagcgtgggcctgagcctggtggatttctga

DBGET integrated database retrieval system