KEGG   Acidovorax ebreus: Dtpsy_3304Help
Entry
Dtpsy_3304        CDS       T00853                                 

Definition
fructose-bisphosphate aldolase, class II, calvin cycle subtype (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
dia  Acidovorax ebreus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dia01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dia01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dia00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dia00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dia00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:dia00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3530830..3531894)
Genome map
AA seq 354 aa AA seqDB search
MPLVSMRELLDHAADHGYGIPAFNVNNLEQVQAVMAAADEVGAPVILQASAGARKYAGES
FIKHLIAAAAEAYPHIPLVMHQDHGTSPAICKGALELGFGSVMMDGSLREDGKTPADFDY
NVRVTQEVVAMAHKIGATVEGELGCLGSLETGEAGEEDGVGAAGKLSHAQLLTDPEEAAQ
FVKATQLDALAIAIGTSHGAYKFSRPPTGDVLSIQRVKEIHARIPNTHLVMHGSSSVPQD
LLALINQFGGKMKETYGVPVAEIQEAIKHGVRKINIDTDIRLAMTGAVRKFQAENPDKFD
MREWMKPAREAAKAICKQRYLEFGCEGQGAKVKGYTLSEMAAKYASGALQQVVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgtctcgatgcgcgaactgctcgaccatgccgccgaccacggctatggcatt
cccgccttcaacgtcaacaacctggagcaggtgcaggccgtgatggccgctgccgacgag
gtgggcgcgccggtgatcctgcaagccagcgccggcgcccgcaagtacgccggcgagagc
tttatcaagcacctgatcgccgccgctgccgaggcgtatccgcacatccccctggtcatg
caccaggaccatggcaccagccccgccatctgcaagggcgcgctggagctgggcttcggc
tcggtgatgatggacggctcgctgcgcgaagacggcaagacccccgcagacttcgactac
aacgtgcgcgtcacccaggaagtggtggccatggcgcacaagatcggcgctaccgtcgaa
ggcgaactgggctgcctgggcagcctggagaccggcgaggcgggtgaggaagacggcgtc
ggcgcggctggcaagctcagccacgcccagctgctcacggaccccgaggaggctgcgcag
ttcgtcaaggccacgcaactggacgccctggcgatcgccatcggtaccagccatggggcc
tacaagttctctcgcccgcccacgggcgatgtgctgtcgatccagcgcgtcaaggaaatc
cacgcgcgcattcccaacacccacctggtgatgcatggctcgtccagcgtgccgcaggat
ctgctggccctcatcaaccagtttggcggcaagatgaaggaaacctacggcgtgcccgtg
gccgagatccaggaagccatcaagcacggcgtgcgcaagatcaacatcgacaccgatatc
cgcttggccatgaccggggcggtgcgcaagttccaagccgagaacccggacaaattcgac
atgcgcgagtggatgaagcccgcgcgcgaagccgccaaggccatctgcaagcaacgctac
ctggagtttggctgcgagggtcagggcgcgaaggtgaagggctataccctcagcgaaatg
gctgccaaatacgccagcggcgcgctgcagcaggtcgtgaactga

DBGET integrated database retrieval system