KEGG   Acidovorax ebreus: Dtpsy_3304Help
Entry
Dtpsy_3304        CDS       T00853                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
dia  Acidovorax ebreus
Pathway
dia00010  Glycolysis / Gluconeogenesis
dia00030  Pentose phosphate pathway
dia00051  Fructose and mannose metabolism
dia00680  Methane metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01200  Carbon metabolism
dia01230  Biosynthesis of amino acids
Module
dia_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_3304
   00030 Pentose phosphate pathway
    Dtpsy_3304
   00051 Fructose and mannose metabolism
    Dtpsy_3304
  Energy metabolism
   00680 Methane metabolism
    Dtpsy_3304
Enzymes [BR:dia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Dtpsy_3304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ACM34733
UniProt: B9MHM4
Position
complement(3530830..3531894)
Genome map
AA seq 354 aa AA seqDB search
MPLVSMRELLDHAADHGYGIPAFNVNNLEQVQAVMAAADEVGAPVILQASAGARKYAGES
FIKHLIAAAAEAYPHIPLVMHQDHGTSPAICKGALELGFGSVMMDGSLREDGKTPADFDY
NVRVTQEVVAMAHKIGATVEGELGCLGSLETGEAGEEDGVGAAGKLSHAQLLTDPEEAAQ
FVKATQLDALAIAIGTSHGAYKFSRPPTGDVLSIQRVKEIHARIPNTHLVMHGSSSVPQD
LLALINQFGGKMKETYGVPVAEIQEAIKHGVRKINIDTDIRLAMTGAVRKFQAENPDKFD
MREWMKPAREAAKAICKQRYLEFGCEGQGAKVKGYTLSEMAAKYASGALQQVVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgtctcgatgcgcgaactgctcgaccatgccgccgaccacggctatggcatt
cccgccttcaacgtcaacaacctggagcaggtgcaggccgtgatggccgctgccgacgag
gtgggcgcgccggtgatcctgcaagccagcgccggcgcccgcaagtacgccggcgagagc
tttatcaagcacctgatcgccgccgctgccgaggcgtatccgcacatccccctggtcatg
caccaggaccatggcaccagccccgccatctgcaagggcgcgctggagctgggcttcggc
tcggtgatgatggacggctcgctgcgcgaagacggcaagacccccgcagacttcgactac
aacgtgcgcgtcacccaggaagtggtggccatggcgcacaagatcggcgctaccgtcgaa
ggcgaactgggctgcctgggcagcctggagaccggcgaggcgggtgaggaagacggcgtc
ggcgcggctggcaagctcagccacgcccagctgctcacggaccccgaggaggctgcgcag
ttcgtcaaggccacgcaactggacgccctggcgatcgccatcggtaccagccatggggcc
tacaagttctctcgcccgcccacgggcgatgtgctgtcgatccagcgcgtcaaggaaatc
cacgcgcgcattcccaacacccacctggtgatgcatggctcgtccagcgtgccgcaggat
ctgctggccctcatcaaccagtttggcggcaagatgaaggaaacctacggcgtgcccgtg
gccgagatccaggaagccatcaagcacggcgtgcgcaagatcaacatcgacaccgatatc
cgcttggccatgaccggggcggtgcgcaagttccaagccgagaacccggacaaattcgac
atgcgcgagtggatgaagcccgcgcgcgaagccgccaaggccatctgcaagcaacgctac
ctggagtttggctgcgagggtcagggcgcgaaggtgaagggctataccctcagcgaaatg
gctgccaaatacgccagcggcgcgctgcagcaggtcgtgaactga

DBGET integrated database retrieval system