KEGG   Acidovorax ebreus: Dtpsy_3304Help
Entry
Dtpsy_3304        CDS       T00853                                 

Definition
fructose-bisphosphate aldolase, class II, calvin cycle subtype (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
dia  Acidovorax ebreus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtpsy_3304
   01230 Biosynthesis of amino acids
    Dtpsy_3304
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_3304
   00030 Pentose phosphate pathway
    Dtpsy_3304
   00051 Fructose and mannose metabolism
    Dtpsy_3304
  Energy metabolism
   00680 Methane metabolism
    Dtpsy_3304
Enzymes [BR:dia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Dtpsy_3304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3530830..3531894)
Genome map
AA seq 354 aa AA seqDB search
MPLVSMRELLDHAADHGYGIPAFNVNNLEQVQAVMAAADEVGAPVILQASAGARKYAGES
FIKHLIAAAAEAYPHIPLVMHQDHGTSPAICKGALELGFGSVMMDGSLREDGKTPADFDY
NVRVTQEVVAMAHKIGATVEGELGCLGSLETGEAGEEDGVGAAGKLSHAQLLTDPEEAAQ
FVKATQLDALAIAIGTSHGAYKFSRPPTGDVLSIQRVKEIHARIPNTHLVMHGSSSVPQD
LLALINQFGGKMKETYGVPVAEIQEAIKHGVRKINIDTDIRLAMTGAVRKFQAENPDKFD
MREWMKPAREAAKAICKQRYLEFGCEGQGAKVKGYTLSEMAAKYASGALQQVVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgtctcgatgcgcgaactgctcgaccatgccgccgaccacggctatggcatt
cccgccttcaacgtcaacaacctggagcaggtgcaggccgtgatggccgctgccgacgag
gtgggcgcgccggtgatcctgcaagccagcgccggcgcccgcaagtacgccggcgagagc
tttatcaagcacctgatcgccgccgctgccgaggcgtatccgcacatccccctggtcatg
caccaggaccatggcaccagccccgccatctgcaagggcgcgctggagctgggcttcggc
tcggtgatgatggacggctcgctgcgcgaagacggcaagacccccgcagacttcgactac
aacgtgcgcgtcacccaggaagtggtggccatggcgcacaagatcggcgctaccgtcgaa
ggcgaactgggctgcctgggcagcctggagaccggcgaggcgggtgaggaagacggcgtc
ggcgcggctggcaagctcagccacgcccagctgctcacggaccccgaggaggctgcgcag
ttcgtcaaggccacgcaactggacgccctggcgatcgccatcggtaccagccatggggcc
tacaagttctctcgcccgcccacgggcgatgtgctgtcgatccagcgcgtcaaggaaatc
cacgcgcgcattcccaacacccacctggtgatgcatggctcgtccagcgtgccgcaggat
ctgctggccctcatcaaccagtttggcggcaagatgaaggaaacctacggcgtgcccgtg
gccgagatccaggaagccatcaagcacggcgtgcgcaagatcaacatcgacaccgatatc
cgcttggccatgaccggggcggtgcgcaagttccaagccgagaacccggacaaattcgac
atgcgcgagtggatgaagcccgcgcgcgaagccgccaaggccatctgcaagcaacgctac
ctggagtttggctgcgagggtcagggcgcgaaggtgaagggctataccctcagcgaaatg
gctgccaaatacgccagcggcgcgctgcagcaggtcgtgaactga

DBGET integrated database retrieval system