KEGG   Acidovorax ebreus: Dtpsy_3304Help
Entry
Dtpsy_3304        CDS       T00853                                 

Definition
(RefSeq) fructose-bisphosphate aldolase, class II, calvin cycle subtype (EC:4.1.2.13)
  KO
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
dia  Acidovorax ebreus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtpsy_3304
   01230 Biosynthesis of amino acids
    Dtpsy_3304
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_3304
   00030 Pentose phosphate pathway
    Dtpsy_3304
   00051 Fructose and mannose metabolism
    Dtpsy_3304
  Energy metabolism
   00680 Methane metabolism
    Dtpsy_3304
Enzymes [BR:dia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Dtpsy_3304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3530830..3531894)
Genome map
AA seq 354 aa AA seqDB search
MPLVSMRELLDHAADHGYGIPAFNVNNLEQVQAVMAAADEVGAPVILQASAGARKYAGES
FIKHLIAAAAEAYPHIPLVMHQDHGTSPAICKGALELGFGSVMMDGSLREDGKTPADFDY
NVRVTQEVVAMAHKIGATVEGELGCLGSLETGEAGEEDGVGAAGKLSHAQLLTDPEEAAQ
FVKATQLDALAIAIGTSHGAYKFSRPPTGDVLSIQRVKEIHARIPNTHLVMHGSSSVPQD
LLALINQFGGKMKETYGVPVAEIQEAIKHGVRKINIDTDIRLAMTGAVRKFQAENPDKFD
MREWMKPAREAAKAICKQRYLEFGCEGQGAKVKGYTLSEMAAKYASGALQQVVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgtctcgatgcgcgaactgctcgaccatgccgccgaccacggctatggcatt
cccgccttcaacgtcaacaacctggagcaggtgcaggccgtgatggccgctgccgacgag
gtgggcgcgccggtgatcctgcaagccagcgccggcgcccgcaagtacgccggcgagagc
tttatcaagcacctgatcgccgccgctgccgaggcgtatccgcacatccccctggtcatg
caccaggaccatggcaccagccccgccatctgcaagggcgcgctggagctgggcttcggc
tcggtgatgatggacggctcgctgcgcgaagacggcaagacccccgcagacttcgactac
aacgtgcgcgtcacccaggaagtggtggccatggcgcacaagatcggcgctaccgtcgaa
ggcgaactgggctgcctgggcagcctggagaccggcgaggcgggtgaggaagacggcgtc
ggcgcggctggcaagctcagccacgcccagctgctcacggaccccgaggaggctgcgcag
ttcgtcaaggccacgcaactggacgccctggcgatcgccatcggtaccagccatggggcc
tacaagttctctcgcccgcccacgggcgatgtgctgtcgatccagcgcgtcaaggaaatc
cacgcgcgcattcccaacacccacctggtgatgcatggctcgtccagcgtgccgcaggat
ctgctggccctcatcaaccagtttggcggcaagatgaaggaaacctacggcgtgcccgtg
gccgagatccaggaagccatcaagcacggcgtgcgcaagatcaacatcgacaccgatatc
cgcttggccatgaccggggcggtgcgcaagttccaagccgagaacccggacaaattcgac
atgcgcgagtggatgaagcccgcgcgcgaagccgccaaggccatctgcaagcaacgctac
ctggagtttggctgcgagggtcagggcgcgaaggtgaagggctataccctcagcgaaatg
gctgccaaatacgccagcggcgcgctgcagcaggtcgtgaactga

DBGET integrated database retrieval system