KEGG   Acidovorax ebreus: Dtpsy_3374Help
Entry
Dtpsy_3374        CDS       T00853                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dia  Acidovorax ebreus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dtpsy_3374
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dtpsy_3374
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dtpsy_3374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3614635..3615222
Genome map
AA seq 195 aa AA seqDB search
MPRLTLPLLLCATLLGPAAQAADVAAPPAADARACPALLQHTVPRLQDEAPQALCQYAGK
VLLVVNTASYCGFTGQYQGLEELYARYRDQGLVVLGFPSNDFAQETGSNTEIAQFCENTF
GVRFPMFAKSHVKGGEALPLYRQLAAASAGQTPRWNFHKYLVSRSGKVVGSYGSSVEPHS
KALIQAIEQQLAAPR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcctgactttgccgctgcttctatgcgccacgctgctgggccccgccgcccag
gcggcggatgttgcggcgcctccggccgcagatgcccgggcctgccccgccctgctgcag
cacaccgtgccgcgcctgcaggacgaggcgccgcaggccttgtgccaatacgccggcaag
gtgctgctggtggtcaacacggccagctactgcggcttcaccggccaataccagggcttg
gaagagctgtacgcgcgctaccgcgaccaagggctggtggtgctgggctttccgtcgaac
gactttgcacaagaaaccggcagtaacaccgagatcgcccagttctgcgaaaacacgttt
ggcgtgcgcttcccgatgtttgccaagagccacgtgaagggcggcgaagccctgccgctg
taccgccagctcgccgcagcgtccgcggggcagacgccacggtggaacttccacaagtac
ctggtcagccgttcgggcaaggtggtgggaagctacggaagttcggtggaaccccacagc
aaagcgctgatccaggccatcgagcagcaactggcggcgccgcgttga

DBGET integrated database retrieval system