KEGG   Acidovorax ebreus: Dtpsy_3392Help
Entry
Dtpsy_3392        CDS       T00853                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dia  Acidovorax ebreus
Pathway
dia00020  Citrate cycle (TCA cycle)
dia00640  Propanoate metabolism
dia00660  C5-Branched dibasic acid metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01200  Carbon metabolism
Module
dia_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dia_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dtpsy_3392
   00640 Propanoate metabolism
    Dtpsy_3392
   00660 C5-Branched dibasic acid metabolism
    Dtpsy_3392
Enzymes [BR:dia01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dtpsy_3392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACM34819
UniProt: B9MHW0
Position
complement(3629544..3630704)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRSFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKTIDDVKARASEILGMQLVTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRGTQK
VALIASSEGGMDIEEVAHSTPEKIITEMIDPLTGITPEQSKKVAAAIGLTGASVDQAVDL
FAKLYKCYMDTDASLVEINPLNCDSKGNLMALDAKFNFDANALFRHPEIVALRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATPEKVTE
AFKIMLKNPKVKGILVNIFGGIMKCDTIATGVITACKAVNLQVPLVVRMKGTNEELGKKM
LAESGLPIISADTMAEAATKIVEAVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgaataccaaggcaaggaaatcttgcgcagtttcggcgtgcccgtcccg
cgtggcatccccgctttcacggtgcaagaagccgtggaagccgcacaaaagctcggcggc
cccgtgtgggtcgtgaaggcccagatccacgccggtggccgtggcaagggcggtggcgtg
aaggtggccaagaccattgatgacgtgaaggcacgcgccagcgagatcctgggcatgcaa
ctggtcacgcaccagaccggccctgaagggcagaaggtgcgccgcctgtacattgaagat
ggcgccgacatcaagaacgaactgtatgtgtctctggtgaccgaccgtggcacgcagaaa
gtggcgctgatcgcttccagcgaaggcggcatggacatcgaggaagtggcccactccacg
cccgagaagatcatcaccgagatgatcgaccccctgaccggcatcacgcccgagcaatcc
aagaaggtggccgcagccatcggcctgacgggtgcttcggtggaccaggcggtggacctg
ttcgccaagctctacaagtgctacatggacaccgacgcgtccctggtcgagatcaacccg
ctgaattgcgactccaagggcaacctgatggccctggacgcgaagttcaacttcgacgcc
aacgcgctgttccgccacccggaaatcgtggccctgcgcgacctggacgaggaagatccg
gcggaagtcgaggcctccaagttcgacctggcctacatctccctggacggcaacatcggc
tgcctggtgaacggcgccggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagcctgccaacttcctggacgtgggcggcggtgccacccccgagaaggtcaccgaa
gccttcaagatcatgctcaagaaccccaaggtcaagggcattctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtgatcaccgcctgcaaggccgtgaac
ctgcaggtgccgctggtcgtgcgcatgaagggcacgaacgaagagctgggcaagaagatg
ctggccgaatccggcctgcccatcatcagcgccgacaccatggcggaagccgccacgaag
attgtcgaagccgtccgttaa

DBGET integrated database retrieval system