KEGG   Acidovorax ebreus: Dtpsy_3466Help
Entry
Dtpsy_3466        CDS       T00853                                 

Definition
guanine-specific ribonuclease n1 and t1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
dia  Acidovorax ebreus
Brite
Enzymes [BR:dia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Dtpsy_3466
Transfer RNA biogenesis [BR:dia03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Dtpsy_3466
 Prokaryotic Type
    Dtpsy_3466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3713484..3713888
Genome map
AA seq 134 aa AA seqDB search
MLQAVAIRAYKAMGACVLGAAVTLAPVVVSARQLPDTAANPPISLAELPPQGRATYALIH
EGGPFPYDKDGSVFGNRERLLPLKKRGYYREYTVRTPGVRHRGARRIVCGGAPRTPDACY
FTSDHYASFREIRE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaggctgtcgccatccgggcgtacaaggcaatgggggcgtgcgttctgggtgct
gcggtcacgcttgcgcccgtggtggtgtccgcgcggcagctccctgacactgccgccaat
cctcccatctcgctggctgagctccccccgcaggggcgggctacctatgcgctgatccat
gagggtgggccgttcccgtacgacaaggatggttcggtattcggcaaccgcgagcgtctg
ctccccctgaagaaacgcggctattaccgcgaatacacggtgcgcacgcccggcgtgcgc
caccggggagcgcggcgcatcgtgtgcgggggcgctccccgcacaccggacgcctgctat
ttcaccagcgaccattacgcgagctttcgagaaatcagggaatga

DBGET integrated database retrieval system