KEGG   Acidovorax ebreus: Dtpsy_3466Help
Entry
Dtpsy_3466        CDS       T00853                                 

Definition
guanine-specific ribonuclease n1 and t1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
dia  Acidovorax ebreus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3713484..3713888
Genome map
AA seq 134 aa AA seqDB search
MLQAVAIRAYKAMGACVLGAAVTLAPVVVSARQLPDTAANPPISLAELPPQGRATYALIH
EGGPFPYDKDGSVFGNRERLLPLKKRGYYREYTVRTPGVRHRGARRIVCGGAPRTPDACY
FTSDHYASFREIRE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaggctgtcgccatccgggcgtacaaggcaatgggggcgtgcgttctgggtgct
gcggtcacgcttgcgcccgtggtggtgtccgcgcggcagctccctgacactgccgccaat
cctcccatctcgctggctgagctccccccgcaggggcgggctacctatgcgctgatccat
gagggtgggccgttcccgtacgacaaggatggttcggtattcggcaaccgcgagcgtctg
ctccccctgaagaaacgcggctattaccgcgaatacacggtgcgcacgcccggcgtgcgc
caccggggagcgcggcgcatcgtgtgcgggggcgctccccgcacaccggacgcctgctat
ttcaccagcgaccattacgcgagctttcgagaaatcagggaatga

DBGET integrated database retrieval system