KEGG   Desulfurispirillum indicum: Selin_0130Help
Entry
Selin_0130        CDS       T01383                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
din  Desulfurispirillum indicum
Pathway
din00010  Glycolysis / Gluconeogenesis
din00051  Fructose and mannose metabolism
din00562  Inositol phosphate metabolism
din01100  Metabolic pathways
din01110  Biosynthesis of secondary metabolites
din01120  Microbial metabolism in diverse environments
din01130  Biosynthesis of antibiotics
din01200  Carbon metabolism
din01230  Biosynthesis of amino acids
Module
din_M00002  Glycolysis, core module involving three-carbon compounds
din_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selin_0130
   00051 Fructose and mannose metabolism
    Selin_0130
   00562 Inositol phosphate metabolism
    Selin_0130
Enzymes [BR:din01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Selin_0130
Exosome [BR:din04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Selin_0130
  Exosomal proteins of bladder cancer cells
   Selin_0130
  Exosomal proteins of melanoma cells
   Selin_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU64888
JGI: Selin_0130
UniProt: E6W5F7
Position
140246..140992
Genome map
AA seq 248 aa AA seqDB search
MRTTYLVGNWKMHYAPADTRTFLARFLSRIGTVTAGREIVFCPPALSLESALEAVKSTPV
SVGAQNVHHKESGAYTGEISAPMLQSMGVKYGIVGHSERRQYFGESDVLVNQKAVALLNC
DITPIICVGETLEQREAGEAQVIVRQQVEAAVAGMDITRLIIAYEPVWAIGTGKTATPAD
AQEVHDVIRDTLRSLGDSQRVPILYGGSVKPENIDSLMAQPDIDGALVGGASLEVESFLR
ICQYNAGS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccacgtatcttgtcggcaactggaaaatgcactatgcgcctgcggatacccgc
acctttctggcgcgtttcctgtcgcgtattggcaccgtcaccgccggacgtgaaattgtc
ttctgtccccctgctctctctttggagagcgcccttgaggcggtaaaaagcacgccggtg
tccgtcggcgcccagaatgttcaccacaaggagtcgggagcctataccggagagatatcc
gcacccatgctgcagtccatgggggtgaaatacggtattgttggtcactcggagcgtcgc
cagtattttggtgaaagtgatgtgctggtgaaccagaaggctgttgccctgctcaactgt
gacattactcccatcatctgtgtgggcgagaccctggagcagcgtgaagccggtgaggcg
caggtgattgtgcggcagcaggtggaagcagccgttgccggcatggatatcacccgcctg
attattgcctatgaaccggtgtgggccattggcaccggcaagacggcaacgcccgctgac
gctcaggaggttcacgacgtgattcgcgataccctgcgctccctgggagacagccagcgg
gtgccgattctttacggtggatcagtaaagccggagaatattgacagcctcatggctcag
cccgatatcgacggagccctggtcggtggagcgagccttgaagtggagagtttcctgcgt
atctgccagtataacgccggaagttga

DBGET integrated database retrieval system