KEGG   Desulfurispirillum indicum: Selin_0160Help
Entry
Selin_0160        CDS       T01383                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
din  Desulfurispirillum indicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Selin_0160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Selin_0160
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Selin_0160
Enzymes [BR:din01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Selin_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(175801..176544)
Genome map
AA seq 247 aa AA seqDB search
MNIYSRIIPYITLGYPDLETTQAFLELCYELGIKRIEIGIPFSDPMADGPVIQEANDYAL
ARGINFRSLEALRIDTGKADHYVMTYANLFYHYGPADTFQWLTRLGYRGAIIPDLSFEQR
DDFAAEVPEDFALVPFIATTTDDGRVEAITSRSAGFIYAVSSPNVTGQAVDNFSLIEAKI
SLARQHTSTPIFIGFGIKDGQTAAKAMAIADGAIIGTALIQCIQPDAGRERNISALRQFL
QGLQLAD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctacagccgcatcattccctacatcacccttggctatcccgacctggaaacg
acccaggcctttcttgagctgtgctacgagctgggcatcaagcgtattgagatcggcatt
cccttttccgaccccatggcagacgggccggtgatccaggaggccaatgactacgccctg
gcgcggggtatcaacttccgcagtctggaagcgctgcgcatcgacacgggcaaggccgac
cactatgtcatgacctacgccaaccttttttatcactatggtccggctgacacgttccag
tggcttacccggcttggctaccgtggcgcgatcatccccgatctgagctttgagcagcgt
gacgactttgcggcggaggttcccgaagactttgcgctggtgccctttatcgccaccaca
actgacgatgggcgagtggaagcgattacctcccgctcggcgggattcatctatgccgtc
agctcacccaatgtcacgggtcaggcagtggataacttctcgcttattgaggcaaaaatt
tcgctggcccgccagcacaccagcacccccattttcatcggctttggcatcaaggatggc
cagacggcggccaaagccatggcgatcgccgatggcgccatcatcggcacggccctgatc
cagtgcattcagccggatgccggcagggagcgcaatatcagcgcgttgcgccaattcctt
cagggattgcaacttgcagactaa

DBGET integrated database retrieval system