KEGG   Desulfurispirillum indicum: Selin_0303Help
Entry
Selin_0303        CDS       T01383                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
din  Desulfurispirillum indicum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Selin_0303
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Selin_0303
   00640 Propanoate metabolism
    Selin_0303
   00660 C5-Branched dibasic acid metabolism
    Selin_0303
Enzymes [BR:din01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Selin_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
339956..341125
Genome map
AA seq 389 aa AA seqDB search
MNIHEYQGKELFEQYGIPVPKGKVAYTNWQAEDITRSLGGKSVVKVQIHAGNRGASGGVK
LVSSSKEAKDLAEHFFNTPIKTAQTGGKSKQVRRILVEEQRVINKEFYLSMIVDREERRI
AIIASTEGGVNIEEVAEQHPEKILMEHIELSIGILDFQIRKLAFSLGLAGEQIRQFSTIV
KGLYKLFTEKDCSQIEINPLIVTDDGSLLALDAKVNFDENALMRHPEILELRDFAEEDPL
EVEASRYNLSYIALDGTIGCMVNGAGLAMATMDIIQHYGGEPANFLDVGGGANTEKVSNA
FSIILRDEKVKAILVNIFGGIMKCDIIAQGVVEAAKTMDVKVPIIIRLAGTNLEEGMKVI
EQSGQNLIVAKTLEEAAKLAVEKARGGVA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtatcagggcaaagaactttttgagcagtatggcattcctgttccc
aagggcaaagtggcctacaccaactggcaggctgaagacatcacccgcagcctgggcggg
aaatctgtcgttaaagtacaaatccacgcgggcaaccgcggtgccagtggtggcgtgaag
ctggtaagcagctccaaggaagccaaggacctggcagaacacttttttaatacccctatc
aagacagctcagacgggcggaaaatccaagcaggtgcggcgcatcctggtggaagagcag
cgtgtcatcaacaaggaattctacctgagcatgatcgttgaccgcgaagagcgtcgcatt
gccattatcgcctccaccgaaggcggtgtgaatatcgaggaagtcgccgagcagcatccc
gaaaaaattctcatggagcacatagagctctccatcggcattctggacttccagatccgc
aagctggccttttccctcgggctggccggggagcagatccgccagttttccaccattgtc
aaaggtctctataagctctttacggaaaaagactgcagccagattgagatcaaccccctg
attgtcaccgacgatggcagcctgttggcccttgatgccaaggtgaatttcgatgaaaac
gccctgatgcgtcatcccgaaattcttgagctgcgggattttgccgaagaggaccccctg
gaagtggaggccagccgctataatctcagttacatcgcccttgacggcaccattggctgt
atggtcaacggcgctggcctggccatggctaccatggacatcatccagcactatggcggc
gagccggccaatttcctggatgtgggaggcggtgccaatacagagaaggtttccaacgcc
ttcagcatcattctgcgcgacgaaaaggtcaaagccatcctggtcaatattttcggtggc
atcatgaagtgtgacatcattgcccagggtgtggtggaagccgcgaagaccatggatgtc
aaggtacccattatcattcgcctggcgggaaccaacctggaggaaggcatgaaggttatc
gaacagtcggggcagaacctgattgtggccaaaaccctggaggaagccgccaagcttgcg
gtggaaaaagccagaggaggtgtggcatga

DBGET integrated database retrieval system