KEGG   Desulfurispirillum indicum: Selin_0309Help
Entry
Selin_0309        CDS       T01383                                 

Definition
(GenBank) Glutaminase, core
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
din  Desulfurispirillum indicum
Pathway
din00220  Arginine biosynthesis
din00250  Alanine, aspartate and glutamate metabolism
din00471  D-Glutamine and D-glutamate metabolism
din01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Selin_0309
   00220 Arginine biosynthesis
    Selin_0309
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Selin_0309
Enzymes [BR:din01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Selin_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADU65065
JGI: Selin_0309
UniProt: E6W6R5
Position
complement(348065..348979)
Genome map
AA seq 304 aa AA seqDB search
MNSQEILDDIVAAIRPQLGKAGAVANYIPALARVNPCQFGIALRTRDGVEAWAGDAMTPF
SIQSISKVFSLTMAMRLAGERLWERIGREPSGNPFNSLMQLESEQGIPRNPFINAGAIAV
ADCLVTCGDDPKSEMLALISSLCDEPVHIDEEVAASEAATGFRNVALANFIKSFGKLDND
VCTVLDVYFRQCAIPMNCLQLARAVNFLCRDGSHPFSGVQVISARQARRINALMLTCGTY
DAAGEFAFLIGLPCKSGVGGGIVAIVPDTLSLCVWSPALDASHNSLLGQKALEMFTSRTG
LSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcaggaaattctcgatgatattgtcgcggcgattcgcccgcagctcggcaaa
gcgggggcagtcgccaactacattccagcgctggcccgggtcaacccctgccagttcggc
atcgccctgcgcacccgcgatggggtcgaggcctgggctggcgatgccatgacgcctttt
tccatccagagtatttccaaggtcttctcgctgaccatggccatgcgcctggcaggggag
cgtttgtgggaacgcatcggcagggagccttccgggaatccctttaactccctgatgcag
ctggagagcgagcagggcattccccgtaatccctttatcaacgcgggtgccattgcggta
gccgactgtctggtcacctgcggcgatgaccccaagtccgagatgctggccctgatatcc
agcctctgcgacgagccggtacacattgacgaggaagtggctgcttccgaagcagccacc
ggatttcgcaacgtggcgctggcgaacttcatcaagagcttcggcaaactggacaatgac
gtctgcacggtgctggatgtctacttccgccagtgcgccatccccatgaattgcctgcag
ctggcccgggcagtcaatttcctgtgtcgcgatggcagccaccccttcagcggggtacag
gtgatcagcgcccggcaggcccgccgcatcaacgccctgatgctgacctgcggcacctat
gacgcggccggtgaattcgcctttctcatcggcctgccctgtaaaagtggtgtgggagga
ggtattgtggcgattgtgccggacaccttgagcctgtgcgtgtggtctccggctctggat
gccagccacaactctctgctgggacagaaggccctggaaatgttcacgtcacgcaccggg
ctctcgatattctga

DBGET integrated database retrieval system