KEGG   Desulfurispirillum indicum: Selin_0309Help
Entry
Selin_0309        CDS       T01383                                 

Definition
glutaminase, core (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
din  Desulfurispirillum indicum
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:din00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:din00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:din00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(348065..348979)
Genome map
AA seq 304 aa AA seqDB search
MNSQEILDDIVAAIRPQLGKAGAVANYIPALARVNPCQFGIALRTRDGVEAWAGDAMTPF
SIQSISKVFSLTMAMRLAGERLWERIGREPSGNPFNSLMQLESEQGIPRNPFINAGAIAV
ADCLVTCGDDPKSEMLALISSLCDEPVHIDEEVAASEAATGFRNVALANFIKSFGKLDND
VCTVLDVYFRQCAIPMNCLQLARAVNFLCRDGSHPFSGVQVISARQARRINALMLTCGTY
DAAGEFAFLIGLPCKSGVGGGIVAIVPDTLSLCVWSPALDASHNSLLGQKALEMFTSRTG
LSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcaggaaattctcgatgatattgtcgcggcgattcgcccgcagctcggcaaa
gcgggggcagtcgccaactacattccagcgctggcccgggtcaacccctgccagttcggc
atcgccctgcgcacccgcgatggggtcgaggcctgggctggcgatgccatgacgcctttt
tccatccagagtatttccaaggtcttctcgctgaccatggccatgcgcctggcaggggag
cgtttgtgggaacgcatcggcagggagccttccgggaatccctttaactccctgatgcag
ctggagagcgagcagggcattccccgtaatccctttatcaacgcgggtgccattgcggta
gccgactgtctggtcacctgcggcgatgaccccaagtccgagatgctggccctgatatcc
agcctctgcgacgagccggtacacattgacgaggaagtggctgcttccgaagcagccacc
ggatttcgcaacgtggcgctggcgaacttcatcaagagcttcggcaaactggacaatgac
gtctgcacggtgctggatgtctacttccgccagtgcgccatccccatgaattgcctgcag
ctggcccgggcagtcaatttcctgtgtcgcgatggcagccaccccttcagcggggtacag
gtgatcagcgcccggcaggcccgccgcatcaacgccctgatgctgacctgcggcacctat
gacgcggccggtgaattcgcctttctcatcggcctgccctgtaaaagtggtgtgggagga
ggtattgtggcgattgtgccggacaccttgagcctgtgcgtgtggtctccggctctggat
gccagccacaactctctgctgggacagaaggccctggaaatgttcacgtcacgcaccggg
ctctcgatattctga

DBGET integrated database retrieval system