KEGG   Desulfurispirillum indicum: Selin_0568Help
Entry
Selin_0568        CDS       T01383                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
din  Desulfurispirillum indicum
Brite
Enzymes [BR:din01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Selin_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(605317..606339)
Genome map
AA seq 340 aa AA seqDB search
MKEKKSKGIIFGTLAIVGTSLIIAACSGSSQQALDPKEVFSNLGPMPVPADNPMTPEKIE
LGKMLYFDTRLSGDNTLSCASCHEPEKGWSDGRRTFLGFQGHQGHRNSPTIINSGYHSLQ
FLDGRMKTLEDQALGPIQDPGEMNLSLDELVQKLNAVPAYVQKFEEIFGPDSINPTNIGK
AIATFERTIVIDNTPFDQYLKGNSNAMSKDAQEGMKLFAGKASCISCHNGPSLSDNNFHN
VGVLNDNPGRAGFTGNPEDDGKYKTTHLRGIGHTAPFMHNGSLRTLRDVVEFKNRGGDGH
PNTSPLVRPLNLSDKEKAQLVAFLEALTGELPLVAKPQLP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagagaagaagagcaaaggtattattttcggcacactggcaatcgtgggcacatcg
ctcatcatcgccgcctgcagtggctcatcccagcaggcccttgatcccaaggaagtcttt
tccaacctgggccccatgcccgttccggctgacaaccccatgactcccgagaaaatcgaa
ctgggcaagatgctctactttgacacacgcctgtccggagacaacacgctcagctgcgcc
agctgtcacgaaccggaaaagggctggagcgacggacgccgcaccttcctgggcttccag
gggcatcagggacaccgcaactctcccactatcatcaacagtggctaccacagcctgcag
ttcctggatggccgcatgaagaccctggaagatcaggcccttggccccattcaggatccc
ggcgaaatgaacctctccctggatgagcttgtacagaaactcaatgcagttccagcttat
gtgcagaaattcgaagaaattttcggccctgacagcatcaacccgacaaatattggcaag
gccatcgccacctttgaacgtaccattgtcatcgacaacacgccctttgaccagtacctc
aagggcaacagcaacgccatgtcaaaggatgcccaggaaggcatgaagctctttgccggc
aaagccagctgcatcagctgccataacggccccagcctctccgataataacttccacaat
gtgggcgtcctcaatgacaaccccggccgcgccggcttcaccggaaaccctgaagatgac
ggcaagtacaagaccacccatctgcgtggtatcggccacacggctccctttatgcacaac
ggcagtctgcgcaccctgcgtgatgtcgtggaattcaagaaccgcggcggcgatgggcac
cccaacaccagccccctggttcgtcctctgaacctcagcgataaggaaaaagcacagctg
gttgccttcctggaagctctgaccggcgagctgcccctggttgccaagccacaactgcca
tag

DBGET integrated database retrieval system