KEGG   Desulfurispirillum indicum: Selin_0772Help
Entry
Selin_0772        CDS       T01383                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
din  Desulfurispirillum indicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Selin_0772
Enzymes [BR:din01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Selin_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(819274..820659)
Genome map
AA seq 461 aa AA seqDB search
MTERIAIIGGGLSGLGTAYYLHQGAPDARITVFEAAPRTGGKIQTSRGEFTCESGPNGFL
DSRPEIVQLSHELGLTATLLPANANSARRFIYSSARLNEIHAHPLKFMASPLLSPLGKLR
LCLEHFAPKPRAEDETLEEFGCRKLGREAFERLIDPMASGVYAGNPAHMSVRSCFPRIYQ
MERQYGSLTRALFAIKKEKKQQGETSSGPAGPAGLLTSFKGGLYEMIEALQEQCGATIRT
NCPVLNLTCSQDSQWEVWTSAGKETFDAVVCATPAWDSADILHSGFAELAGKLRAIQSSP
ISVVALAYDTPSLSGVDTNGFGFLVPGREGRKLLGSLWSSSIFQHRAPAGTFLTQCMVGG
ARQPELALLDDDALVQLVRDELRITMGIAAEPIYRKIFRWDAGIPQYNMGHSQILSDIEE
LRRHTPRLYFTGNSYRGISVNDCVVDARSISELLLREGRTP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgtattgccattatcggcggcggcctcagcggccttggtaccgcctattac
ctgcatcagggtgcaccggatgccaggattaccgttttcgaagccgcacccagaaccggc
ggaaagatacagacatcccgcggggagttcacctgtgagtccgggcccaacggcttcctg
gacagtcgaccggagatcgtccagctcagccacgagctgggactgaccgcaaccttgctt
cccgccaacgccaacagcgcccgccgctttatctattccagcgccaggctcaatgaaatc
cacgctcacccgctgaagttcatggcaagtccgctgctgagcccccttggcaagctgcgc
ctgtgcctggagcactttgcccccaagccacgggctgaggatgagaccctggaggaattc
ggctgccgcaagctcggtcgcgaagcctttgagcggctgatcgaccccatggccagcggt
gtctatgccggaaaccccgcgcacatgagcgtcagatcctgcttcccgagaatctaccag
atggagcggcagtatggttccctgacccgcgccctctttgccattaagaaagagaaaaag
cagcagggtgaaacatcctccggcccggcagggcccgccggactgctgacctccttcaag
ggtggactttacgaaatgatagaagccctgcaggagcagtgtggagccaccatccgcacc
aactgccctgtgctcaacctcacctgctcccaggacagtcagtgggaagtctggacttcc
gccggtaaagagacctttgacgccgtcgtatgcgccacgccagcctgggacagcgccgac
atcctgcactccggcttcgccgagctggccgggaagctcagggcaattcaatcgtccccc
atttccgttgtggctctggcctatgatacgccttccttatccggcgtggacaccaacggc
tttggctttctggtgccaggacgggaaggacgcaaactgctgggttccctgtggagcagt
tccatcttccagcatcgcgccccggcaggcaccttcctgacccagtgcatggtgggcgga
gcccgccagcctgagctggcgctattggatgacgatgctctggtgcagctggtgcgcgac
gaactccgcatcaccatgggcattgccgcagagcccatctaccgcaaaatcttccgctgg
gatgccggaatcccccagtataacatgggccacagccagatactcagtgacattgaagag
ctgcgtcgccacacacctcggctgtacttcaccggtaactcataccgtggtatctccgtc
aacgactgcgttgtggacgcgcgcagcataagcgagctgctgctgcgcgaaggcaggact
ccctga

DBGET integrated database retrieval system