KEGG   Desulfurispirillum indicum: Selin_0785Help
Entry
Selin_0785        CDS       T01383                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
din  Desulfurispirillum indicum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Selin_0785
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Selin_0785
Enzymes [BR:din01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Selin_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
839045..840157
Genome map
AA seq 370 aa AA seqDB search
MKRWLRFGIIGLTLLGGAPGPVSGSDISLERMVGQMVLAGFRGLEVQPDDPIMQDISHGF
VGGVILFDRDVLTGSRERNVRDREQLSRLIADLQEHASTVLFIAIDQEGGLVSRLKPVHG
FEALASHRELGEGSPSSTFAAASDMAQALAGLGVNLNFAPVVDVNMNPENPVIGSLGRSF
SADASAVARHGEQFARAMDAAGVIPAIKHFPGHGSSLADSHLGFTDITQTWNPHELLPFR
EMIANGFGGMVMTGHLFHRELDAEYPATLSRVVLQDLLRQELGFTGVIVSDDMQMKAITD
HFGFEEALERAVYAGVDILLLGNNLEYDPLVARRAVKAIVEMVERGTLPRERIEASYERI
QALKRQLEKP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtggcttcgctttgggattatcggactgacactgcttggtggggcccctggc
cctgtttccggcagtgacatttccctggaacggatggtcgggcaaatggtgctggctggt
tttcgcggactggaagtgcagccggacgatcccatcatgcaggatatctcccatggcttt
gtgggcggggtgattctgttcgatcgggatgtgctcaccggcagtcgggagcgcaatgtg
cgtgaccgggagcagctttcccggctgatagctgatctgcaggaacatgcctccacggtt
ctgttcatcgccattgatcaggaaggggggctggtcagccgtctgaagccggttcatggt
tttgaggcgctggcctcccaccgtgagctgggcgaggggagcccgagcagcacctttgcg
gcggccagcgacatggcacaggccctggccgggcttggtgtcaacctgaactttgcaccg
gtggtggatgtgaatatgaatccggaaaacccggttatcggcagcctgggacgcagtttt
tccgccgatgcttctgcggtggcgcgccatggggagcagttcgcccgggccatggatgct
gctggcgtgattcctgccatcaagcactttcccgggcacggcagctctctggcggattcc
cacctggggtttacggatattacgcagacctggaatccccatgagctcctgcccttccgg
gaaatgatcgccaatggatttggcggcatggtgatgaccggacacctgttccaccgggag
cttgatgcagaatatccggcaacgctctcccgggtggtactccaggatctgctgcgccag
gagctgggttttacgggggtgattgtctccgatgatatgcagatgaaggccataaccgac
cacttcggctttgaagaggctctggagcgggctgtttatgccggggtggatattctgctg
ctgggcaacaatctggaatatgaccctctggtggcccggcgggcagtcaaagccattgtg
gagatggtggagcggggaactcttccccgtgagcgcattgaagcttcctacgagcgaatt
caggcgctgaaacggcagctggaaaagccgtga

DBGET integrated database retrieval system