KEGG   Desulfurispirillum indicum: Selin_0815Help
Entry
Selin_0815        CDS       T01383                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
din  Desulfurispirillum indicum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Selin_0815
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Selin_0815
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Selin_0815
Enzymes [BR:din01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Selin_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
871712..872773
Genome map
AA seq 353 aa AA seqDB search
MYQGLIYRFQDRLPVSEKTPMISLCEGNTPLIACRNLVEAIGNPNLEIFLKYEGLNPTGS
FKDRGMFLAVAKAVEDGAKAIICASTGNTSASAAAYAARAGIKAYVLIPDGKIAFGKLSQ
AVMHGARVIQIDGNFDDALNLVRDISDKFPVALVNSVNPYRIEGQKTAAFEIIEALGDAP
DYHVIPVGNAGNITAYWKGYREYHQAGKSTRLPKMLGFQAAGSAPIVLGHPVKEPETIAT
AIRIGNPASWKQAEAARDESGGLIDMVTDEEILEAYNLLARTEGVFCEPASAATIAGVIK
LNNAGYFTGRCRLTCTLTGHGLKDPDTAMKQKIDLVKSSSDMPSVLAALGLEA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaaggacttatataccgttttcaagaccgcctgcctgtgagcgaaaaaacccct
atgatcagcctgtgcgaaggcaacacacccctgattgcctgcagaaatctggtcgaagcc
atcggcaatcccaacctggaaatattcctgaagtatgaaggcctgaaccccaccggctcc
tttaaagaccgtggcatgttcctggccgtagccaaggccgtagaagacggagccaaggcg
atcatctgcgcttccaccggcaatacttccgcctcggcagcggcttatgcggccagggcg
ggtatcaaggcctatgtcctgatccccgatggaaaaatagcttttggcaaactttcccag
gcggtcatgcacggcgcccgcgtcattcagatcgacggaaacttcgacgatgccctgaac
ctggtgcgcgatatctccgataaattcccggtagcactggtgaacagcgtcaacccctat
cgtattgagggccagaagactgccgcctttgaaatcattgaggcccttggcgatgctccc
gactatcacgtcattcccgtcggcaatgccggcaacatcacggcttactggaaaggctac
cgcgagtaccaccaggcgggcaagtcaacacgcctgccaaaaatgctcggcttccaggct
gccggctccgctcctattgtactcggacatccggtcaaggaaccggaaaccatcgccacg
gcaatccgcatcggcaatccagccagctggaagcaggcggaagcggcccgcgatgaatcg
ggcggcctgatcgacatggtaacggacgaggagattctggaggcgtacaacctgctggca
cgcaccgagggcgtcttctgcgaaccggccagtgcggcaaccattgccggcgtcatcaaa
ctcaataacgccggatacttcacgggccgctgccgtctcacctgcactctgacaggtcac
ggtctcaaagaccccgacaccgccatgaaacagaagatcgacctggtgaagtccagcagt
gatatgcccagtgtgctggccgccctgggactggaggcatga

DBGET integrated database retrieval system