KEGG   Desulfurispirillum indicum: Selin_0848Help
Entry
Selin_0848        CDS       T01383                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
din  Desulfurispirillum indicum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:din00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
904204..904818
Genome map
AA seq 204 aa AA seqDB search
MKTMDYDTKQSSSLPAIEDSVATILQAIGEDSDREGLLKTPQRVARMYRELTSGYRTDIH
EIINDAIFASEDEDMVLVKDISFSSLCEHHMLPFLGKAHVAYIPDGNIIGLSKIPRIVEM
YARRLQVQERMTAQIGKTLFDVLKPRGVAVMVESVHMCAIIRGVKNHSTTMTTTSMFGSF
KEDRHLRSEFMEHTANTSRTSIHW
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactatggattatgatacgaagcaaagcagctcgctgccagcaatagaggattcg
gtcgccacaatactgcaggccattggcgaagactcggaccgtgaggggcttctgaagact
ccccagcgggttgcacgcatgtaccgtgaactgaccagcggctaccgcacagatattcat
gaaattatcaatgacgcgatctttgccagcgaagacgaggatatggtgctggtcaaagac
atcagcttctcttcgctgtgcgagcaccacatgctgcccttcctgggcaaagcccatgtg
gcctatattcccgatggtaacatcatcgggctttcaaaaattccgcgtatcgtcgaaatg
tatgcgcgacgcctgcaggtacaggagcgcatgacggcccagatcggcaaaacgctcttt
gacgtgctcaaacccaggggagtggcggtcatggttgaatcggtgcacatgtgcgccatc
atccggggagtcaaaaaccactccaccaccatgacaacgacatccatgttcggcagcttc
aaagaggaccgccacctgcgcagtgaattcatggagcacacagccaacacttcgcgcaca
tccatccactggtaa

DBGET integrated database retrieval system