KEGG   Desulfurispirillum indicum: Selin_0862Help
Entry
Selin_0862        CDS       T01383                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
din  Desulfurispirillum indicum
Pathway
din00010  Glycolysis / Gluconeogenesis
din00030  Pentose phosphate pathway
din00051  Fructose and mannose metabolism
din00052  Galactose metabolism
din00680  Methane metabolism
din01100  Metabolic pathways
din01110  Biosynthesis of secondary metabolites
din01120  Microbial metabolism in diverse environments
din01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selin_0862
   00030 Pentose phosphate pathway
    Selin_0862
   00051 Fructose and mannose metabolism
    Selin_0862
   00052 Galactose metabolism
    Selin_0862
  Energy metabolism
   00680 Methane metabolism
    Selin_0862
Enzymes [BR:din01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Selin_0862
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Selin_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat UPF0261
Motif
Other DBs
NCBI-ProteinID: ADU65602
JGI: Selin_0862
UniProt: E6W2L8
Position
complement(929267..930361)
Genome map
AA seq 364 aa AA seqDB search
MAIEIRKIAISTGGGDCPGLNAVIRAVVRTANIKYGWEVVGIKDGLQGVMDTTTKLIPLN
RHNVAGFLQKGGTVLGTTNRGNPFEIKQEIDGRMQTVDISDAVVENIRREHIDAVVGIGG
DGTMLIMNQLYKKGIPIVGVPKTIDNDLLSTDVTFGFDTAVAIATDALDRLQTTAASHHR
VMVVELMGRYAGWIALHSGIAGGAEVILIPEIPYNIERVCDVIRQRMKREGFSIVVVAEG
AKPVGGSHSVLHEGGQGAVERLGGVAYKVAEEIEHFTGAEVRTTVLGHVQRGGAPTAYDR
VLSTRFGVAAADLIHEGNFGRMVTLRGTEICDVTFEEAIENLKFVDPDGQLVRAAEEIGV
CLGR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaggaaaattgccatttccacgggcgggggggactgtccggggctg
aacgcggttatcagggctgtggtgcgaaccgcaaacatcaaatatggctgggaagttgtc
ggtatcaaggatggcctgcagggcgtcatggatacgaccaccaagctgattcccctgaat
cgccataatgtggcgggttttctgcagaaaggcggcacggttctgggcaccaccaaccgt
ggaaacccttttgaaatcaaacaggaaatagatggccgcatgcagacggtggatatcagc
gacgcggtcgtggaaaatatccgccgggagcatatagacgccgtggtcggtatcggtggc
gatggcaccatgctgatcatgaatcagttgtacaagaagggtatacccatcgtgggagtg
ccgaagaccattgataacgacctgctttccaccgatgtcacctttggttttgatacggcg
gtggccattgccaccgatgctctggatcgcctgcagacaacggcagccagccatcaccgg
gtgatggtcgttgagctgatgggccgctatgcgggctggattgccctgcacagcggtatt
gctggtggggctgaagtgattctcatccccgagattccctataatatagaacgtgtctgc
gatgtgatccggcagcgcatgaagcgcgaaggcttttccatcgtcgtggtggctgaaggg
gccaagccggttgggggaagtcactcggtcctccatgagggtggtcagggcgcggtggag
cgcctgggaggcgtcgcctataaggtggccgaggaaatagagcactttaccggagctgaa
gtgcgcaccaccgtgcttggccatgtgcagcgggggggggcgccgacggcctacgacagg
gtactttctactcgcttcggggtggcggcagccgatctgatccacgaggggaacttcggt
cgcatggtgaccctgcgtggaacggaaatctgcgatgtgacctttgaggaggccatagag
aatctgaagttcgttgatcccgacgggcagctggtacgcgctgctgaggagatcggcgtc
tgcctgggacgctga

DBGET integrated database retrieval system