KEGG   Desulfurispirillum indicum: Selin_0862Help
Entry
Selin_0862        CDS       T01383                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
din  Desulfurispirillum indicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Selin_0862
   01230 Biosynthesis of amino acids
    Selin_0862
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selin_0862
   00030 Pentose phosphate pathway
    Selin_0862
   00051 Fructose and mannose metabolism
    Selin_0862
   00052 Galactose metabolism
    Selin_0862
  Energy metabolism
   00680 Methane metabolism
    Selin_0862
Enzymes [BR:din01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Selin_0862
Protein phosphatases and associated proteins [BR:din01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Selin_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(929267..930361)
Genome map
AA seq 364 aa AA seqDB search
MAIEIRKIAISTGGGDCPGLNAVIRAVVRTANIKYGWEVVGIKDGLQGVMDTTTKLIPLN
RHNVAGFLQKGGTVLGTTNRGNPFEIKQEIDGRMQTVDISDAVVENIRREHIDAVVGIGG
DGTMLIMNQLYKKGIPIVGVPKTIDNDLLSTDVTFGFDTAVAIATDALDRLQTTAASHHR
VMVVELMGRYAGWIALHSGIAGGAEVILIPEIPYNIERVCDVIRQRMKREGFSIVVVAEG
AKPVGGSHSVLHEGGQGAVERLGGVAYKVAEEIEHFTGAEVRTTVLGHVQRGGAPTAYDR
VLSTRFGVAAADLIHEGNFGRMVTLRGTEICDVTFEEAIENLKFVDPDGQLVRAAEEIGV
CLGR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaggaaaattgccatttccacgggcgggggggactgtccggggctg
aacgcggttatcagggctgtggtgcgaaccgcaaacatcaaatatggctgggaagttgtc
ggtatcaaggatggcctgcagggcgtcatggatacgaccaccaagctgattcccctgaat
cgccataatgtggcgggttttctgcagaaaggcggcacggttctgggcaccaccaaccgt
ggaaacccttttgaaatcaaacaggaaatagatggccgcatgcagacggtggatatcagc
gacgcggtcgtggaaaatatccgccgggagcatatagacgccgtggtcggtatcggtggc
gatggcaccatgctgatcatgaatcagttgtacaagaagggtatacccatcgtgggagtg
ccgaagaccattgataacgacctgctttccaccgatgtcacctttggttttgatacggcg
gtggccattgccaccgatgctctggatcgcctgcagacaacggcagccagccatcaccgg
gtgatggtcgttgagctgatgggccgctatgcgggctggattgccctgcacagcggtatt
gctggtggggctgaagtgattctcatccccgagattccctataatatagaacgtgtctgc
gatgtgatccggcagcgcatgaagcgcgaaggcttttccatcgtcgtggtggctgaaggg
gccaagccggttgggggaagtcactcggtcctccatgagggtggtcagggcgcggtggag
cgcctgggaggcgtcgcctataaggtggccgaggaaatagagcactttaccggagctgaa
gtgcgcaccaccgtgcttggccatgtgcagcgggggggggcgccgacggcctacgacagg
gtactttctactcgcttcggggtggcggcagccgatctgatccacgaggggaacttcggt
cgcatggtgaccctgcgtggaacggaaatctgcgatgtgacctttgaggaggccatagag
aatctgaagttcgttgatcccgacgggcagctggtacgcgctgctgaggagatcggcgtc
tgcctgggacgctga

DBGET integrated database retrieval system