KEGG   Desulfurispirillum indicum: Selin_0899Help
Entry
Selin_0899        CDS       T01383                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
din  Desulfurispirillum indicum
Brite
Enzymes [BR:din01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Selin_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
971664..972329
Genome map
AA seq 221 aa AA seqDB search
MLETARHMMVEKYLRNRIEDERVLSVIGELPRHLFVEDALQGRAYSNDALPIGFGQTISQ
PFIVALMTQELELSGQETVLEIGTGSGYQAAVLSHLAREVHSVERIPQLAQRAAKVLQSM
HIDNVCVHIADGTAISGDQHPLPAKFDRIIVTAGGNRQPSSLLRQLHIGGILLIPIGDSQ
QQSLFKYRRISEERWERQNLHQCSFVKLVGKEGWSPGEDAP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaaccgcccgccacatgatggtagagaagtacctgcgcaaccgcatagaagat
gaacgggtactgagtgtcatcggagagcttccgcgccatctcttcgtcgaggatgccctg
cagggacgcgcctacagtaatgacgccctgcctatcggattcggccagaccatttcccag
ccctttattgtcgccctcatgacccaggagctggaactttccggccaggagaccgtcctg
gaaatcggtaccggcagtggctaccaggctgccgtgctctcccacctcgcccgggaagtg
cacagtgtcgaacgcattccgcagctggcgcagcgcgccgctaaagtccttcagtccatg
catattgacaatgtctgcgtgcatatcgccgacggcactgccatatccggtgaccagcat
cccctgccggcaaaattcgaccgcattatcgtcactgccggcggcaatcgtcagccaagc
tcacttttgcgccagctgcatatcggcggcattctgctcattcccattggcgacagccag
cagcaaagccttttcaaatatcgccgcatcagcgaagagcgctgggagcggcagaatctc
caccagtgcagctttgtcaaactggtgggcaaagagggctggagccctggggaggatgca
ccgtga

DBGET integrated database retrieval system