KEGG   Desulfurispirillum indicum: Selin_0902Help
Entry
Selin_0902        CDS       T01383                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
din  Desulfurispirillum indicum
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:din00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Selin_0902
Enzymes [BR:din01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Selin_0902
Amino acid related enzymes [BR:din01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Selin_0902
Transfer RNA biogenesis [BR:din03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Selin_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(973564..975006)
Genome map
AA seq 480 aa AA seqDB search
MVRVRFAPSPTGHLHVGGARTALFNYFYAKAQGGRLILRVEDTDQARSTRESEAMVLEDL
RWLGVQWDEGPDVGGDYGPYRQSERTGIYLEYARKLLEADKAYHCYCTDAELEASREEAT
RLKITPHYNGRCRNLSPEQAAAFEKEGRRPTVRFRAPLRDYVLNDIIRGDVTFKDGMIGD
FIIMRSDGMPVYNFCVSIDDVLMEITHVIRAEEHLSNTLRQMMICEALGVEPPRYAHVSL
ILGEDRSKLSKRHGATSVGQYQEKGYLPEAMVNYLSLLGWSSGSEEELFSVERIIELFSL
ERINRAAAVFDNAKLDWMNAHYIREADLPRITALMKPYLMQTGLIDGAKDENQLQLEIDI
IRGNCTVLADVSTYYPIFLDRDPLLEEDGRAFLQLETSRPLVEEVLKRVEALSQALDGEV
YKDMVKEAGKVVGVKGKNLFMTLRVALTGKCRGPELDLLVPVLGQSVVCRRLRWALEQMN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggtacgagtccgatttgccccaagccccactggtcacctgcacgtgggtggcgcgcga
actgcgctgttcaattacttttatgccaaagcccaggggggcaggctcatcctgcgggtg
gaggacacggatcaggcccgcagcacccgtgaaagtgaagccatggtgctggaagatctg
cgctggctcggtgttcagtgggatgaaggccccgatgtgggtggcgattacggcccctat
cgccagtccgaacgcaccggaatctacctggaatacgcccgcaaactgctggaggctgac
aaggcttaccactgctactgcactgatgcagagctggaagcctcccgtgaggaagccacc
cgcctgaagatcaccccccactacaatggccgctgccgaaatctcagcccggagcaggct
gccgcctttgaaaaagagggacgcaggcccaccgtgcgctttcgcgcgcccctgcgggac
tatgtcctcaacgacatcatccgcggcgacgtcaccttcaaggatggcatgatcggcgac
ttcatcatcatgcgttccgacggcatgcccgtctataatttctgtgtcagcattgacgat
gtcctcatggagatcacccacgtcatccgcgctgaggagcacctcagcaataccctgcgc
cagatgatgatctgcgaagccctgggcgtggagcccccccgttacgcccatgtcagtctg
attctgggcgaggatcgctccaagctcagcaagcgccacggtgccaccagcgtgggccag
taccaggaaaagggctacctgcctgaagctatggtcaactacctgagcctgctgggctgg
agcagtggcagcgaagaggagttgttcagcgtggagcgcatcatcgagctgttcagcctg
gagcgcatcaaccgcgccgccgctgtcttcgacaacgccaagctggactggatgaacgcc
cactacatccgcgaagccgacctgccgcgcatcacggcgctgatgaaaccgtacctgatg
cagacaggtctcatagatggtgccaaggacgagaatcagctgcagcttgagattgatatt
atccggggcaactgtacggtgctggcagatgtgagcacctattaccccattttcctcgac
cgcgatccactcctggaggaagatggccgcgcgtttttgcagctggaaaccagccgtccc
ctggtcgaggaggtgttgaagcgtgtggaagctctctcccaggctcttgatggggaagtg
tataaggatatggtcaaggaagcgggcaaggtcgtgggtgtgaaggggaagaatctcttt
atgaccctgcgggtggctttgaccggcaagtgccgtggtccggagcttgatctgctggta
ccggtgctgggccagtccgtggtctgccggcgtctgcgctgggcactggagcagatgaat
tga

DBGET integrated database retrieval system