KEGG   Desulfurispirillum indicum: Selin_0912Help
Entry
Selin_0912        CDS       T01383                                 

Definition
copper-translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
din  Desulfurispirillum indicum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
982151..984643
Genome map
AA seq 830 aa AA seqDB search
MDSQQLTIGIRGMTCAGCAGRAEKALQAVSGVTSATVNLATEQASVTFDSSATTTSAIVN
ALEQTNYKPITEQLSFAVQGMSCATCAGKVERALMGLSGVADASVNLATSQATVTYVPAS
VTPDQLRESVRKAGYQVEQVQTADATPQIDRIQQQRHEESGELRRSLLLAAILTIPIFVL
DMFPMWIPALEQWLFQQISPRTLHFLFFVLASIVQFGPGWRFYQKGWPALRSAAPDMNSL
VMLGTSAAYGYSVIATFLPGILPAGTVHVYYEASTVIITLILLGRYLEARAKGKTSQAIQ
KLIGLQPRTARVERDGRELDLDTAQVVRDDTVIVRPGERIPVDGMVVDGSSYVDESMISG
EPLPVHKETGSEVIGGTVNTTGSFRIKATKVGADTVLAQIVRMVEQAQGSKLPIQALVDR
VVLYFVPAVLAAAAFTFFIWLLIGPAPALTFALVNMVAVLIIACPCAMGLATPTSIMVGT
GKAAETGILFRNGIALQHLREATVIALDKTGTITQGQPQLTDIHIAESFEKTDVLRLVAS
AESKSEHPVAQAICQYAQQQGAALTDAASFRALPGLGVEATIDGQLVQVGADRYMQQLGL
DLSPFAAIVTQLSDAGKTPLYAAIDGTLAATISVSDPVKPSSATAIQALHAMGLRTVMIT
GDNQRTAQAIARTLGIDDVLAEIMPDGKADAVRQLQDNGSKVAFVGDGINDAPALAQSDV
GLAIGTGTDIAIESADVVLMSGDLRNVANAIALSRATLRNIKQNLFWAFAYNTSLIPVAA
GILYPVAGILLSPMLAALAMGLSSVCVLSNALRLRHFRPPVRMQATPSNP
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggattcccagcagcttaccataggtatccgcggcatgacctgcgccggctgtgccggt
cgggcggaaaaagccctgcaggccgtatccggtgtcaccagcgccacggtcaatctggcc
accgaacaggccagcgtcacctttgacagcagcgccaccacgaccagcgccatcgttaac
gcccttgaacagaccaactacaaacccattaccgaacagctgagcttcgcggtccaggga
atgagctgcgccacctgcgccgggaaagtggaaagggcgctcatgggactcagcggcgtt
gccgacgccagcgtcaacctggcaacgtcccaggccaccgtcacctatgtgcccgccagc
gtcacccctgaccagctgcgcgaatccgtgcgtaaggcgggctatcaggtggaacaggtc
cagacagccgacgccacacctcagattgaccgcattcagcagcagcgccatgaagaatcc
ggtgaactgcgccgcagcctgctgctggcagcgatcctcaccatacccatcttcgtgctg
gatatgttccccatgtggataccggccctggagcagtggctcttccagcagatatccccg
cgtactcttcacttcctcttcttcgtcctggcctccattgtccagttcggccccggctgg
cgcttctaccagaagggctggcccgccctgcgcagcgccgcccccgatatgaactccctg
gtcatgctgggcaccagcgccgcctatggctactccgtcatcgccaccttcctgcccggc
attctgcccgctggcactgtgcacgtgtactacgaagcatccaccgtcatcatcaccctc
attctgctgggtcgctacctggaggctcgcgccaaagggaaaaccagccaggccatccag
aaactcatcggcctgcagccccgcacggcccgcgtggagcgtgatggccgcgaactggat
ctggacacggcccaggtagtgcgcgacgacaccgtcatcgtgcgccccggcgagcgcatc
cccgttgatggcatggtagtggatggcagctcctatgtggatgagtccatgatcagcgga
gagccgctgcccgttcacaaggaaaccggcagcgaagtcatcggcggcaccgtcaacacc
accggcagcttccgcatcaaggccaccaaggtcggcgcggataccgtgctggcccagatt
gtgcgcatggtggagcaggcccagggctccaaactgcccatccaggccctggtagaccgg
gtcgtcctctactttgtgcccgccgtgctggccgccgccgccttcaccttcttcatctgg
ctgctgatcggcccggccccggccctcaccttcgccctggtgaacatggtcgccgtactc
atcatcgcctgcccctgcgccatgggcctggctacccccacatccatcatggtgggcact
ggcaaagccgctgaaaccggcatcctcttccgtaacggcatcgccctgcagcacctgcgt
gaagccacggtgatcgccctggataaaaccggcaccatcacccagggtcagccgcagctg
accgatatccacatcgccgagagcttcgagaaaaccgacgtcctgcgcctggtagcctcg
gcggaaagcaagagtgagcaccccgtcgcccaggccatctgtcagtacgcgcagcagcag
ggagcagccctgacggatgccgccagtttccgcgccctgccagggcttggcgtagaggcc
accattgacggccagctggttcaggtgggtgccgaccgctatatgcagcagctggggctc
gacctgtccccattcgccgccatcgtgacccagctgtccgatgccggcaagactccgctc
tacgccgccattgacggcaccctggccgccaccatcagcgtctcggaccccgtcaaaccc
tccagtgccacagccattcaggccctccacgccatgggcctgcggaccgttatgataacc
ggcgacaaccagcgcaccgcccaggccatcgccaggaccctgggtattgacgacgtgctg
gcggaaatcatgcccgacggcaaagcggacgccgtccgccagctgcaggacaacggcagc
aaggtcgcctttgtgggcgacggcatcaacgacgctcctgccctggcccagtccgacgtt
ggcctggccatcggcaccggcaccgacatcgccattgaatccgccgatgtggtcctcatg
tccggcgacctgcgcaatgtggccaacgccatcgccctctcgcgggcaaccctgcgcaat
atcaagcagaacctcttctgggcctttgcctacaacaccagcctcattcccgtcgccgcc
ggcattctctatcctgtggcgggcatcctgctctcacccatgctggcagccctggccatg
ggactctccagcgtgtgcgtcctcagcaatgccctgcgcctgcgtcacttccgtccacca
gtgcgaatgcaggccacaccctcgaacccgtga

DBGET integrated database retrieval system