KEGG   Desulfurispirillum indicum: Selin_0991Help
Entry
Selin_0991        CDS       T01383                                 

Definition
PAS sensor protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
din  Desulfurispirillum indicum
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:din00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Selin_0991
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Selin_0991
Enzymes [BR:din01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Selin_0991
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Selin_0991
Two-component system [BR:din02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Selin_0991
Bacterial motility proteins [BR:din02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Selin_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1072744..1076589
Genome map
AA seq 1281 aa AA seqDB search
MEQPAKGIYIVGIGASAGGLEALRALTSHLPADGDIAYIIAQHLSPSHRSMLVSLLAKEC
LLPVLEAVDGAAVEAGHIYITPPNYDITLTADEKIRLRQPAQPMGPKPSVDTLLCSLAEV
KKEKAIAIILSGTGSDGSVGVRAIKAEGGIVIAQEPSTAKYDSMPNAAISTTHVDLVLPP
ERIGQEVPEIFRFPEKFLVEKQIKKAPGNIDRIFRILTERGEVDFSGYKLTTLNRRIERR
MAATRVTNLGDYVSLLEESADEWKLLFKDILISVTAFFRDRESFNSLEKALESLVANKRN
GDSIRVWVPGCATGEEAYTLAVMLWEIVHRMGKKCHMQIFATDIDTDALMHARKGLYSQA
LLEGMEPALLEKYFTRKGSSFEVAKFLREMIVFSRHNLIKDPPFLRIDLISCRNLLIYFT
QPLQKKVFSLFHYSLAPKGILFLGKSESIGDNETLFASFHDKAKIYERKGGVKSPIVSGN
GNYALLRRSATPAPKPAKEYRLEDALAQTCLKLFSKCSIVVDCEYSIIHVRGDASNFLTL
PSGDFSGNALKMLPRELGIDLRAAVGRLSSGDVPLFRGNLHKIQTGSTWSYVRILASRVE
HEGEAVGYFLIVLEEEDNAFALQHCPVESVSEDGHVQIQELQHELISSKEHLQTVIEELE
TSNEELQSLNEELQSANEELQSSNEELETTNEELQSTNEELSSAYAELKVVYDEKESQRL
ELVNKTHELQESQQVLEVRQNFITGIMQTSPVGILRIDRDRKIDFINAYAEKLLGFAEHS
LLGNSYHVVESLLKSLDAKKLTAEQKPLACALKNKRTLHNLEYAVSALTDVARTLSISIT
PNFSPGGIFESAVLALVDITEKKRIERELKQKQTELEFINHNLEKRVNEEVQRRMNRETL
INAIYDEANVAIGITDTKARIIHANKAFCTTFGYTYDEIIGQSFLVLVPPNRQQAYRQKH
RSLMESQDQDRAVERVMRHRNGATLEVLVSRKAIITEDSTPALLSIITDITSMKRIQREK
EQQEKILIQQTKMAAMGEMVSAIAHQWRQPLNVVGMLVQDIRDSYRYGMLDQGSLDVKVQ
RTMETIRFMSDTIDDFRNFFIPDKEKERFDVMESLRQVAHMLSSQMRSHNVVLYRQHVRS
GKCVPLLEDKSRSSAPYLVTGYPNEFKQVLFNLLNNSRDAIMQHRLDHDGQPQDGSIHVS
ISRQGRGRLIIRIVDNGGGIDPEVLPRIFEPYFTTKDQTKGSGITGTGIGLYMAKIIVQD
NMGGKISARSIDGGAEFTIEL
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
gtggagcaaccggccaaggggatctatattgttggtattggggccagtgccggtggtctg
gaagcactgcgtgccctgacttctcacctgcctgccgatggcgatatcgcctatatcatt
gctcaacacctcagccccagccaccgcagcatgctggtgtccctgctggccaaggagtgc
ctgctgccggtactggaagctgttgatggagctgccgttgaagcgggacatatctatatc
acccctcccaactatgatatcaccctgaccgccgatgagaaaatccgcctgcgccagccg
gcgcaacctatgggccccaagccttcggtggataccctgctgtgctccctggccgaagtg
aaaaaagagaaggccatcgccattattctttccggcaccggctccgatggctcggtgggc
gtgcgtgccatcaaggccgaggggggcatcgtcattgcccaggaaccttcgaccgccaag
tatgacagcatgccgaacgcggcaatttccactacccatgttgatctggttttgccgccg
gagcgcatcgggcaggaagttcccgaaatattccgctttccggaaaaattcctggtggaa
aagcagatcaaaaaggcaccagggaatattgaccgtatcttccgcatcctcaccgagcgt
ggtgaggtggacttttccggctacaaactcaccacgttgaaccggcgcattgaacggcgt
atggcggccacacgggttaccaacctcggggactacgtcagcctgctggaagaatctgcc
gacgagtggaagctgctcttcaaggacattctcatcagtgtgacggcttttttccgcgac
agggagtcctttaactccctggaaaaggctctggaaagcctggtggcgaacaaacgcaat
ggtgacagtatccgcgtgtgggtgcccggctgcgccaccggcgaagaggcctacaccctg
gccgttatgctgtgggagatcgtgcaccgcatggggaaaaagtgccatatgcagatcttt
gccacggatattgataccgacgcactgatgcacgcccgcaaggggctctactcccaggca
ctactggagggcatggagccggctttgctggagaagtactttacccgcaaaggctccagc
tttgaagttgccaaattcctgcgggagatgatcgtcttttcccgtcacaacctcattaaa
gatccccccttcctgcgtatcgacctgatcagttgccgcaacctcctgatctactttact
cagccactgcagaagaaggtgttctcgctgttccactactctctggcccccaagggcatc
ctgtttctggggaaatcggaatccatcggggacaacgaaacgctctttgcctctttccac
gacaaagccaaaatttacgaacgcaaagggggggtgaagtctcccatcgtcagcggaaac
ggcaactatgctctgctgcgtcgcagtgcgacaccggcacccaagccggccaaagagtac
cgcctggaagatgctctggcgcagacgtgcctgaagcttttctccaagtgcagcattgtg
gttgactgcgagtacagcatcatccatgtgcgaggcgatgcttcaaacttcctgaccctg
cccagtggtgacttcagcggcaatgccctgaaaatgctgccccgtgagctgggtattgat
ctgcgcgctgctgttggcaggctctcttcgggcgatgtacctctttttcgggggaatctg
cataaaatccagacgggcagcacctggagctacgtgcgcattctcgcgtcgcgggtggag
cacgaaggtgaagcggtggggtactttctcattgtgctggaggaagaggataatgccttt
gccctgcagcattgtcctgtcgaaagtgtcagtgaagacggacatgtccagatacaggag
ctgcagcacgagctgatttccagcaaggagcatctgcagacggtaattgaggagcttgaa
acctccaatgaggaactgcagtcactgaacgaagagctgcagtcggccaatgaggaattg
cagtcttccaacgaggagcttgagaccaccaacgaagagctgcagtccacaaacgaggaa
ctcagttccgcctatgccgaactgaaagtagtctacgacgagaaggaaagccagcgcctc
gagctggtgaacaagacccatgagctccaggaatcccagcaggtgctggaggttcgacag
aacttcattaccggcattatgcagacaagcccggtgggcatactgcgcatcgaccgcgat
cgcaaaatagactttatcaatgcctatgctgaaaagctgctcggcttcgcggaacactcc
ctgctggggaacagctaccacgtggtggaatcgttgctcaaaagccttgatgcaaaaaaa
ctcaccgctgagcaaaaacccctggcctgcgccctgaaaaacaaacgaaccctgcataat
ctggaatacgcggtcagcgcgttgactgatgtggcgcgcacgctgtccatcagcatcacg
ccgaacttctctccgggggggatctttgagagtgcggtgctggcactggtggatatcacc
gagaaaaagcggattgaaagagagctcaaacagaaacagaccgagctggaattcatcaac
cataatctggagaaacgcgtcaacgaggaagtgcagcgacgcatgaatcgggaaacgctc
atcaacgccatctacgacgaagccaatgtggctattggtattaccgataccaaagcccgc
attattcacgccaacaaagctttctgtaccacttttggctacacctatgacgagatcatc
ggccagtctttcctggtactggtgccgccaaatcgccagcaggcctatcgacagaagcac
cgctccctgatggagagccaggatcaggatcgcgctgtggagcgggtcatgcgccacagg
aacggcgccacgctggaggtgctcgtcagccgcaaagccattatcaccgaagacagcaca
ccggcgctcctgagtatcattaccgatatcacctccatgaagcgcatccagcgagaaaag
gagcagcaggagaaaatactgatccagcagactaaaatggctgccatgggcgaaatggtc
agtgccatcgcgcaccagtggcggcagccgctgaatgtggtgggcatgctggtgcaggat
atccgcgactcctatcgctacggaatgctggatcagggctcccttgacgtgaaagtgcag
cgcaccatggagaccatccgcttcatgtccgacaccattgacgactttcgcaacttcttc
atccccgataaggaaaaggagcgttttgacgtcatggaaagcctgcggcaggtggcacac
atgctctccagtcagatgcgctcccacaatgtggttctctatcgtcagcacgtgcgcagc
ggaaagtgtgttcccctgctggaagacaagagcaggagcagcgctccgtacctggtcacc
ggataccccaatgaatttaagcaggtgctgtttaacctgctcaataactcccgcgatgcc
attatgcagcatcggctggaccacgatggacagccccaggatggcagcattcatgtcagt
atcagtcgtcagggtcgaggcaggctgatcatcaggatcgtcgataacgggggcggtatc
gacccggaagtcttgccgcgcatttttgaaccgtactttaccaccaaggaccagacgaaa
ggctcaggcattaccggaaccggaatcggcctctatatggcgaaaatcattgtccaggat
aacatgggtggaaagatcagcgcgcgaagtattgatggtggggcagaatttaccattgaa
ctttag

DBGET integrated database retrieval system