KEGG   Desulfurispirillum indicum: Selin_1120Help
Entry
Selin_1120        CDS       T01383                                 

Definition
Arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
din  Desulfurispirillum indicum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Selin_1120
Enzymes [BR:din01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Selin_1120
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Selin_1120
Lipid biosynthesis proteins [BR:din01004]
 Fatty acid synthase
  Component type
   Selin_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1231529..1232146)
Genome map
AA seq 205 aa AA seqDB search
MRCILLTALMVMGILFAVASAQPTPKILIVGDSIAAGYGVAESEAWVNLLQERLREQGFS
HQIINAAISGDTSASGASRIDDLLQRHQPQLVVIELGGNDGLRGLPLDHIRQNLVTMIEH
SRNAGARVVLVGMQIPPNYGPRYADAFARLFPDLAAEYDTALVERFLEEVGQNPALMQSD
GIHPATAAQPLLMERIWPVLRSQLF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgtatccttctgacagctttgatggtgatgggaatcctgtttgccgtggcgtca
gcccagccgacaccgaaaatcctcatcgtgggtgacagtatcgcggcgggttacggcgtc
gccgaatcggaagcctgggttaacttactacaggaacggttgcgcgaacaaggattttcc
caccaaatcatcaatgccgccatcagcggtgataccagcgcttctggcgccagccgcatc
gatgacctgctgcagcgccaccaaccccagctcgtggtgattgaactggggggcaacgat
ggcctgcgcggcttgcccctggaccatatccgccagaatctcgtcaccatgattgagcac
tcgcggaatgcgggtgcccgcgtggtgctggtgggcatgcagattccacccaactacggc
ccccgctatgccgatgccttcgcccggctctttcctgatctggctgctgagtatgatacc
gccctggtggaacgttttctggaagaggtggggcagaatcccgccctgatgcagtccgac
ggcatccatcccgctacggctgcgcagccgctcctgatggagaggatctggcccgtcctg
cgatcccagctgttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system