KEGG   Desulfurispirillum indicum: Selin_1134Help
Entry
Selin_1134        CDS       T01383                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
din  Desulfurispirillum indicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:din00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Selin_1134
Enzymes [BR:din01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Selin_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1247614..1248222)
Genome map
AA seq 202 aa AA seqDB search
MISLVSGTVHSLTQDRATILTSGGVGYELSIPASLATSLKVDQTVSIQTWMGVKEDAITL
YGFSSSEEKALFLLLMKVSGIGAKIALAAVGTLNTQQLGNAIAMGDIATIQRIPGVGKKV
AEKIALELKDKVTPAAATSSAPQAFTGTTSGTPSVFADAVQGLIALGLRREEADSAARRA
MAAGADSETSIIREVLRQRGHQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatttccctcgtcagcggcacggtacacagcctcacccaggatcgcgccaccatactg
acctccggtggagtcggctacgaactctccatccccgcctccctggccacctcgctgaag
gtggatcagacggtgagcattcagacctggatgggcgtcaaagaagatgccatcaccctg
tatggattcagcagcagtgaagagaaagccctcttcctgctcctcatgaaagtctccggc
atcggagcgaagattgccctggccgcagtgggcaccctgaacacgcaacagctgggcaac
gccatcgccatgggcgacatcgccacgattcagcgtattcccggtgtgggcaagaaagtg
gctgaaaagatcgccctggaactcaaggacaaggtcactcccgctgccgccaccagcagc
gcgccccaggcctttaccggcaccacttccgggacaccatcggtctttgccgatgcggta
cagggcctgatcgccctgggactgcgccgcgaagaagccgacagcgccgcgcgccgcgcc
atggcagccggagccgacagtgaaacctctattatccgtgaagtactcagacagcggggc
catcaatga

DBGET integrated database retrieval system