KEGG   Desulfurispirillum indicum: Selin_1454Help
Entry
Selin_1454        CDS       T01383                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
din  Desulfurispirillum indicum
Brite
Enzymes [BR:din01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Selin_1454
Secretion system [BR:din02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Selin_1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1590731..1591462
Genome map
AA seq 243 aa AA seqDB search
MNNKFKELFSKKPSQAFLATCMAIISAGLIFTWDRSPAGEPVPAVVVSPEQAEEVFRATH
PATTISSVKRSPIPGLFEIHLTNYQIIYFSPETRLTIFGRIMDEFGQDITSMASMDAILP
MALKIGSGSTEVIEVTDPGCSWCLRSYQFFADKDVTKYLLFLGSFAPEKSEHILCSDDPA
AAYHAIYSGQTPDTLLSCDEGKATLSSHRAIAGSLGATGTPTFIINDDVIRGFNQARILE
HLQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaattcaaggaactgttttcgaagaagccctcgcaggcttttctcgctacc
tgcatggcaatcatatcagcgggactgatcttcacctgggaccgaagcccggcaggcgag
ccagtgcctgctgtggttgtgagtcctgagcaggctgaggaggtttttcgcgcaactcat
cctgcaactaccatttccagtgtgaagcgcagccccattccaggactgttcgaaattcac
ctgacaaattaccagatcatctatttctcgcccgaaaccaggctgaccatctttggccgc
atcatggacgagtttggccaggacattacctccatggccagcatggatgccattttgcct
atggctctcaagattggctctggcagtacagaagtgattgaagtcactgaccctggctgc
agctggtgcctgagaagttatcagtttttcgctgataaagatgtcaccaagtacctgttg
tttcttggcagttttgccccggaaaaatccgagcacatcctgtgttcagacgatccggct
gcagcttaccacgctatctatagcggccagacccctgacacgctgctttcctgtgacgag
ggtaaagccaccctgtccagtcaccgggctattgctggctccctcggcgctaccggcact
cccacattcatcatcaacgatgacgtaatccgtggcttcaaccaagcacgaatcctggaa
cacctgcagtga

DBGET integrated database retrieval system