KEGG   Desulfurispirillum indicum: Selin_1882Help
Entry
Selin_1882        CDS       T01383                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
din  Desulfurispirillum indicum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2059919..2060947)
Genome map
AA seq 342 aa AA seqDB search
MGKYAHLKGEISGLSRQALTRLREEGLPATPDYFQIFFEHYAGVNPALSRDIHALESIDE
TSLDVLYQRHFPAVDGQSLKLQEESQKMVALILERLSATLDQFGDDRQQKLESLKEQVSQ
GHVSLETAVHILGDEIGAVAREYGKMRSSLQESLHRMEALRQRYEELGQRARRDFLTGLL
NRQVLEEMLQEICLGEHRHPLGLVAMDIDNFKEINDTYGHLCGDSVLKLFARKLGEYVRR
DDLVFRFGGEEFIVILPQTNLAATYQLAEHIRRHIAEHVFHLEAGGQLSADISLRLTASF
GAASHVAGESHESLLARADQAMYASKRAGRNRTTIAAHPEHP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagtatgcccacctgaaaggggagatatccggcctttcgcgccaggcactgacc
cgtctgcgcgaagagggtctgcctgctacccccgactactttcagatttttttcgagcat
tatgccggggtgaaccctgcgctttcccgcgatattcacgcgctggaatccatcgacgag
acttcgctggatgttctgtaccagcggcactttcccgccgtcgatgggcagagtctcaaa
ctccaggaggagagccagaagatggtggcgctcatactcgagcgcctttccgccaccctt
gaccagtttggtgacgatcgccagcagaagctggaatcactgaaggaacaggtcagccag
ggtcatgtcagcctggaaacagctgttcacatcctgggcgatgagatcggcgccgtggcc
cgggagtacggcaagatgcgcagctccctgcaggagtcattacaccgtatggaagccctg
cgacaacgctatgaggaactgggacagcgtgccagacgggatttcctgacgggcctgctc
aaccgccaggtgctggaggagatgcttcaggagatctgccttggagagcaccgtcatccc
ctgggtctggtagccatggatatagacaacttcaaggagatcaacgatacctacgggcac
ctctgtggggacagtgtcctgaagctctttgcccggaaactcggcgaatacgtgcgtcgt
gatgacctggtattccgcttcgggggcgaggaatttatcgtcatcctgccgcagaccaac
ctggcggcgacctatcagcttgccgagcacattcgccgtcatattgcggagcatgtcttc
cacttggaagcaggcggtcagctcagcgctgacatctcactgcgcctgacagccagtttt
ggcgccgcgagtcatgttgccggcgagagccacgaatctctcctggcccgggccgaccag
gccatgtatgcctcaaaacgcgctggcaggaatcgcaccaccattgccgcgcatccggaa
cacccgtaa

DBGET integrated database retrieval system