KEGG   Desulfurispirillum indicum: Selin_1882Help
Entry
Selin_1882        CDS       T01383                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
din  Desulfurispirillum indicum
Brite
Enzymes [BR:din01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Selin_1882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2059919..2060947)
Genome map
AA seq 342 aa AA seqDB search
MGKYAHLKGEISGLSRQALTRLREEGLPATPDYFQIFFEHYAGVNPALSRDIHALESIDE
TSLDVLYQRHFPAVDGQSLKLQEESQKMVALILERLSATLDQFGDDRQQKLESLKEQVSQ
GHVSLETAVHILGDEIGAVAREYGKMRSSLQESLHRMEALRQRYEELGQRARRDFLTGLL
NRQVLEEMLQEICLGEHRHPLGLVAMDIDNFKEINDTYGHLCGDSVLKLFARKLGEYVRR
DDLVFRFGGEEFIVILPQTNLAATYQLAEHIRRHIAEHVFHLEAGGQLSADISLRLTASF
GAASHVAGESHESLLARADQAMYASKRAGRNRTTIAAHPEHP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagtatgcccacctgaaaggggagatatccggcctttcgcgccaggcactgacc
cgtctgcgcgaagagggtctgcctgctacccccgactactttcagatttttttcgagcat
tatgccggggtgaaccctgcgctttcccgcgatattcacgcgctggaatccatcgacgag
acttcgctggatgttctgtaccagcggcactttcccgccgtcgatgggcagagtctcaaa
ctccaggaggagagccagaagatggtggcgctcatactcgagcgcctttccgccaccctt
gaccagtttggtgacgatcgccagcagaagctggaatcactgaaggaacaggtcagccag
ggtcatgtcagcctggaaacagctgttcacatcctgggcgatgagatcggcgccgtggcc
cgggagtacggcaagatgcgcagctccctgcaggagtcattacaccgtatggaagccctg
cgacaacgctatgaggaactgggacagcgtgccagacgggatttcctgacgggcctgctc
aaccgccaggtgctggaggagatgcttcaggagatctgccttggagagcaccgtcatccc
ctgggtctggtagccatggatatagacaacttcaaggagatcaacgatacctacgggcac
ctctgtggggacagtgtcctgaagctctttgcccggaaactcggcgaatacgtgcgtcgt
gatgacctggtattccgcttcgggggcgaggaatttatcgtcatcctgccgcagaccaac
ctggcggcgacctatcagcttgccgagcacattcgccgtcatattgcggagcatgtcttc
cacttggaagcaggcggtcagctcagcgctgacatctcactgcgcctgacagccagtttt
ggcgccgcgagtcatgttgccggcgagagccacgaatctctcctggcccgggccgaccag
gccatgtatgcctcaaaacgcgctggcaggaatcgcaccaccattgccgcgcatccggaa
cacccgtaa

DBGET integrated database retrieval system