KEGG   Desulfurispirillum indicum: Selin_1937Help
Entry
Selin_1937        CDS       T01383                                 

Definition
(GenBank) Pyruvate/ketoisovalerate oxidoreductase, catalytic domain
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
din  Desulfurispirillum indicum
Pathway
din00010  Glycolysis / Gluconeogenesis
din00020  Citrate cycle (TCA cycle)
din00620  Pyruvate metabolism
din00633  Nitrotoluene degradation
din00640  Propanoate metabolism
din00650  Butanoate metabolism
din00680  Methane metabolism
din01100  Metabolic pathways
din01120  Microbial metabolism in diverse environments
din01130  Biosynthesis of antibiotics
din01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selin_1937
   00020 Citrate cycle (TCA cycle)
    Selin_1937
   00620 Pyruvate metabolism
    Selin_1937
   00640 Propanoate metabolism
    Selin_1937
   00650 Butanoate metabolism
    Selin_1937
  Energy metabolism
   00680 Methane metabolism
    Selin_1937
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Selin_1937
Enzymes [BR:din01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Selin_1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_21 Fer4_6 Fer4_2 Fer4_10 Fer4 Fer4_17 Fer4_9 Fer4_7 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADU66664
JGI: Selin_1937
UniProt: E6W238
Position
complement(2124068..2125048)
Genome map
AA seq 326 aa AA seqDB search
MSQDFTLPYSDELGFCNIKMSAVGGDGANMAGKMLFKIALEYMGLDGAFDAKYGSEKKGT
PTDVSVKLCERGIPIRQTGPTDSPHVLVIFREDLIGPLNLIQGVQENAIVIVNTERTPAQ
IREELKLHSGTIICVDALDIASKTRSRLNMPLLSALVYALKLPEDIFEKTIKETWPKPEV
QKSNIEAFEQTLGNKQEEHFPADGKFPLVPGKWTYETPIGWRNQNKGGYMETRLFSLHGK
DMKITRQGLIPLFNAEACIHCAKCFYTCADPGSIIFKDSKMVGYNYAHCKGCLRCVEVCP
THKKGKALSKGMEAEHHDLVTKHTWF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagacttcacactcccttattccgacgaattgggtttttgtaacatcaagatg
tcggcagttgggggcgatggcgccaatatggccggaaaaatgctgtttaaaatcgccctt
gagtacatggggctggacggcgcttttgacgccaaatacggctccgagaaaaaaggaaca
cccacggacgtcagcgtcaagctgtgtgagcgtggcattcccatccgtcaaaccggacct
acggacagtcctcacgttctggtaatattccgtgaagacctcatcggtcctctgaacctg
atacagggtgtgcaggaaaatgccatcgtgatcgtcaacacggagcgcacccccgcccag
atccgtgaagagctcaagctgcacagcggaaccatcatctgtgtcgacgcgctggacatt
gcgtccaaaacccgctcacgcctgaacatgccactgctctccgcactggtatacgccctg
aagctgcctgaagatattttcgagaaaaccatcaaggaaacctggcccaagcctgaggtt
cagaagtccaacatcgaagcgttcgagcagactctgggcaacaagcaggaagagcacttc
cccgctgacggcaaattcccgctggttcctggcaagtggacctatgagacccccattggc
tggcgcaaccagaacaagggtggctacatggaaacccgcctgttctccctgcacggcaaa
gacatgaagatcacccgtcagggcctgattcccctcttcaacgccgaggcctgtatccac
tgcgccaagtgcttctacacctgtgccgaccccggatctatcatctttaaggacagcaag
atggttggttacaactatgctcactgcaaaggctgcctgcgctgcgttgaggtatgtcct
acccataagaagggcaaagccctcagtaagggtatggaagctgagcaccatgatctcgtt
accaagcacacctggttctga

DBGET integrated database retrieval system