KEGG   Desulfurispirillum indicum: Selin_1938Help
Entry
Selin_1938        CDS       T01383                                 

Definition
Zinc finger C4-type protein RecR
Orthology
K06187  
recombination protein RecR
Organism
din  Desulfurispirillum indicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:din00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Selin_1938
DNA repair and recombination proteins [BR:din03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Selin_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2125168..2125794)
Genome map
AA seq 208 aa AA seqDB search
MYALPSVELLAQGLAQIPGIGQKTAERFALEVAAMAPAKRQAIVRAFEELENRLIACDEC
HTLAESSPCPLCRNTSRNRRQLCVVETFHDLVAIENAGVYEGLYHVLGGKVSPVAHCSPQ
DLFLQTLPQRIRELGVAEVIIAASHTPESRITMELVKRSVLSAKTNTQVTFFSSLLPVGA
PLSICAVDILKKAFHARKNAIDDQLNAM
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcacttcccagtgtagagttgctggcgcaggggctggcgcagattccgggtatt
ggtcagaagaccgctgagcgatttgcccttgaggtggccgccatggcccccgcgaagcga
caggccattgtccgggcttttgaagaactggaaaaccgtctgatagcatgtgatgagtgt
cataccctggccgagagctcgccctgcccgctctgtcggaacacttcccgcaaccgacgg
cagctgtgtgtggtggagaccttccacgatctcgtggccattgagaatgccggcgtctat
gaaggcctctaccacgtcctgggtggcaaagtgtcccccgtagcccactgctctccccag
gacctttttctgcagacacttccgcagcgcattcgggagctgggtgtcgcggaagtgatt
attgccgcctcccacaccccggagtcccgcatcaccatggagcttgtgaaaagaagtgtg
ctgagtgcaaaaacaaacacgcaggtcacttttttctcctcactgttgccggtaggcgct
ccactgagcatttgtgcagttgatatcctgaaaaaagcatttcatgccagaaaaaatgcc
attgacgatcaattgaatgccatgtaa

DBGET integrated database retrieval system