KEGG   Desulfurispirillum indicum: Selin_2046Help
Entry
Selin_2046        CDS       T01383                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
din  Desulfurispirillum indicum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Selin_2046
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Selin_2046
Enzymes [BR:din01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Selin_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2236606..2238000
Genome map
AA seq 464 aa AA seqDB search
MRLQQLCQQLGLPHPQVDVEFSRLSRDTRDISPDCLFIAIAGSQFDPHLHLPELLSSGKI
AGALCQHPVDGPNTLVLPDLAEREATIAVAAYGNPSAALKVVGVTGTNGKSSTISYLRQV
YQALGHRTATIGTLGYAIDGGPSAELANTTPCATTLQHILHLCLQHHVEYVFMEVSSHAI
ALGRVQGIRFHGAIFTNLTPDHLDFHGTMDDYLQTKLRLFTPAPPYAIIHTRRIPRKLPP
LPGVLSFGPGEDADIPTTEQQVSPEGIRFCLQGQIYRSPLRGRGNLENVQAVAAFCHHEG
QERQQVARAIAALRPIEGRFMPISHNGRHGIIDYAHTPDALEQLLKSTREICHGRLIVVF
GCGGDRDKTKRPLMGAIASELADICIVTDDNPRTEDPQHIISQIIAAMDMGRTTVIHERL
RAITCARELANGDDLVVIAGKGHEKYQIYGRQKHRFCDAEAFCS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgcgactccaacaactctgccagcagcttggcctgcctcatcctcaagtggatgtggaa
ttcagccgcctgagccgcgatacccgtgatatcagccccgattgtctttttatcgccata
gccggttcccagttcgaccctcacctccatctgcccgagctgctgagctccggaaaaatc
gccggagccctgtgccagcaccccgttgacgggcccaacaccctggtcctgcccgatctg
gcggagcgggaagccaccattgccgtggccgcctatggcaacccgtctgctgccctgaaa
gtcgtcggcgtcaccggaaccaacggcaaaagctccacgatcagctacctccgtcaggtt
taccaggccctgggccatcgaaccgccaccatcggcaccctcggctatgccattgatggt
ggcccgtccgcggagcttgccaacaccacaccctgtgccaccacgctccagcatatcctg
cacctgtgcctccagcaccatgtggagtatgtgttcatggaggtctcttcccatgccatc
gccctgggccgcgtacagggcatcaggttccacggcgccatattcaccaacctcaccccg
gatcacctggatttccacggcaccatggacgactacctgcagacaaaactccggctcttc
acacctgctcccccctacgccatcatccacaccaggcgtatcccccggaagctgcccccc
ctgcccggcgtcctgagtttcggccccggggaagacgctgacatccccacgacggagcag
caggtaagcccggaaggaattcgcttctgcctgcaggggcagatttaccgcagccccctg
cgaggccgtggcaacctggaaaacgtccaggccgtcgccgctttctgccaccatgaaggg
caggaacgccagcaggttgcccgggccatagcagcactgcgccccatagaagggcgtttc
atgcccatttcccacaatggccgccatggcatcatcgactatgcccacacccccgacgct
ctggagcaactactgaaatcgacccgggagatctgccacggcaggctgattgtcgtcttc
ggctgcggcggtgaccgtgataaaaccaaacgccctctcatgggcgccatcgccagcgag
ctggcggatatctgcattgttacagacgacaacccgcgcaccgaagatccccagcacatt
atctcccagattattgccgccatggatatgggcaggacaacagtgatccatgagcgtcta
cgcgcgattacctgcgccagagagctggcaaacggcgatgacctggtggtcatcgccggc
aagggacacgagaagtatcagatttatggccggcagaaacaccgcttctgtgacgcagaa
gccttctgttcctga

DBGET integrated database retrieval system