KEGG   Desulfurispirillum indicum: Selin_2046Help
Entry
Selin_2046        CDS       T01383                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
din  Desulfurispirillum indicum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:din00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:din00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2236606..2238000
Genome map
AA seq 464 aa AA seqDB search
MRLQQLCQQLGLPHPQVDVEFSRLSRDTRDISPDCLFIAIAGSQFDPHLHLPELLSSGKI
AGALCQHPVDGPNTLVLPDLAEREATIAVAAYGNPSAALKVVGVTGTNGKSSTISYLRQV
YQALGHRTATIGTLGYAIDGGPSAELANTTPCATTLQHILHLCLQHHVEYVFMEVSSHAI
ALGRVQGIRFHGAIFTNLTPDHLDFHGTMDDYLQTKLRLFTPAPPYAIIHTRRIPRKLPP
LPGVLSFGPGEDADIPTTEQQVSPEGIRFCLQGQIYRSPLRGRGNLENVQAVAAFCHHEG
QERQQVARAIAALRPIEGRFMPISHNGRHGIIDYAHTPDALEQLLKSTREICHGRLIVVF
GCGGDRDKTKRPLMGAIASELADICIVTDDNPRTEDPQHIISQIIAAMDMGRTTVIHERL
RAITCARELANGDDLVVIAGKGHEKYQIYGRQKHRFCDAEAFCS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgcgactccaacaactctgccagcagcttggcctgcctcatcctcaagtggatgtggaa
ttcagccgcctgagccgcgatacccgtgatatcagccccgattgtctttttatcgccata
gccggttcccagttcgaccctcacctccatctgcccgagctgctgagctccggaaaaatc
gccggagccctgtgccagcaccccgttgacgggcccaacaccctggtcctgcccgatctg
gcggagcgggaagccaccattgccgtggccgcctatggcaacccgtctgctgccctgaaa
gtcgtcggcgtcaccggaaccaacggcaaaagctccacgatcagctacctccgtcaggtt
taccaggccctgggccatcgaaccgccaccatcggcaccctcggctatgccattgatggt
ggcccgtccgcggagcttgccaacaccacaccctgtgccaccacgctccagcatatcctg
cacctgtgcctccagcaccatgtggagtatgtgttcatggaggtctcttcccatgccatc
gccctgggccgcgtacagggcatcaggttccacggcgccatattcaccaacctcaccccg
gatcacctggatttccacggcaccatggacgactacctgcagacaaaactccggctcttc
acacctgctcccccctacgccatcatccacaccaggcgtatcccccggaagctgcccccc
ctgcccggcgtcctgagtttcggccccggggaagacgctgacatccccacgacggagcag
caggtaagcccggaaggaattcgcttctgcctgcaggggcagatttaccgcagccccctg
cgaggccgtggcaacctggaaaacgtccaggccgtcgccgctttctgccaccatgaaggg
caggaacgccagcaggttgcccgggccatagcagcactgcgccccatagaagggcgtttc
atgcccatttcccacaatggccgccatggcatcatcgactatgcccacacccccgacgct
ctggagcaactactgaaatcgacccgggagatctgccacggcaggctgattgtcgtcttc
ggctgcggcggtgaccgtgataaaaccaaacgccctctcatgggcgccatcgccagcgag
ctggcggatatctgcattgttacagacgacaacccgcgcaccgaagatccccagcacatt
atctcccagattattgccgccatggatatgggcaggacaacagtgatccatgagcgtcta
cgcgcgattacctgcgccagagagctggcaaacggcgatgacctggtggtcatcgccggc
aagggacacgagaagtatcagatttatggccggcagaaacaccgcttctgtgacgcagaa
gccttctgttcctga

DBGET integrated database retrieval system