KEGG   Desulfurispirillum indicum: Selin_2157Help
Entry
Selin_2157        CDS       T01383                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
din  Desulfurispirillum indicum
Pathway
din00400  Phenylalanine, tyrosine and tryptophan biosynthesis
din01100  Metabolic pathways
din01110  Biosynthesis of secondary metabolites
din01130  Biosynthesis of antibiotics
din01230  Biosynthesis of amino acids
Module
din_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Selin_2157
Enzymes [BR:din01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Selin_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADU66877
JGI: Selin_2157
UniProt: E6W3C3
Position
2382884..2383645
Genome map
AA seq 253 aa AA seqDB search
MLTTILQHKQQEIADRIHQLDTWKAQAADRSDFRSLVTAMHSGDIAILAEVKKASPSKGL
ICADFDPVAIARAYEQGGAAAISVLTDERFFQGSSPYLSAVRQAVSLPVLRKDFIIHPSQ
VYEAAAIGADAILLIGEALEAPQAQELYDLASEIGLDVLFEVHHQDQLVKLPTNFGGLLG
VNNRDLSTFHVDLQTSVTIAHATGRAVVCESGIGGRDDIESMTRQGIRMFLIGEYLVKQP
DRAAALRQLMGQS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaccatcctccagcacaaacaacaggaaatcgccgaccgcattcaccagctc
gatacctggaaggctcaggctgccgaccgcagcgacttccgctccctggtcacggccatg
cacagcggagatatcgccattctggccgaggtgaaaaaggccagcccctccaaggggctt
atctgcgctgacttcgatcccgtcgccattgcccgcgcttacgagcagggcggtgccgcc
gccatcagtgtcttgaccgacgagcgcttcttccagggcagcagcccgtatctcagcgcc
gtgcgccaggccgtcagcctgcccgtcctgcgcaaggatttcatcatccacccctcccag
gtctatgaagcagctgccatcggagccgatgccattctgctcatcggcgaagccctggaa
gccccccaggcccaggaactctacgacctggcaagcgaaatcggcctggatgtgctcttt
gaagtccaccaccaggaccagctggtcaaactgcccaccaacttcggcggcctgctgggc
gtcaataaccgcgacctctccaccttccatgtggacttgcagacctccgtcaccatcgcc
cacgctacgggccgggccgtggtctgtgaaagcggcatcggcggacgagacgatattgaa
tccatgacccgtcagggcatccgcatgttcctcatcggcgaatacctcgtcaagcagccg
gaccgcgccgccgccctgcgtcagctcatgggacagagctga

DBGET integrated database retrieval system