KEGG   Desulfurispirillum indicum: Selin_2157Help
Entry
Selin_2157        CDS       T01383                                 

Definition
Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
din  Desulfurispirillum indicum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Selin_2157
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Selin_2157
Enzymes [BR:din01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Selin_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2382884..2383645
Genome map
AA seq 253 aa AA seqDB search
MLTTILQHKQQEIADRIHQLDTWKAQAADRSDFRSLVTAMHSGDIAILAEVKKASPSKGL
ICADFDPVAIARAYEQGGAAAISVLTDERFFQGSSPYLSAVRQAVSLPVLRKDFIIHPSQ
VYEAAAIGADAILLIGEALEAPQAQELYDLASEIGLDVLFEVHHQDQLVKLPTNFGGLLG
VNNRDLSTFHVDLQTSVTIAHATGRAVVCESGIGGRDDIESMTRQGIRMFLIGEYLVKQP
DRAAALRQLMGQS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaccatcctccagcacaaacaacaggaaatcgccgaccgcattcaccagctc
gatacctggaaggctcaggctgccgaccgcagcgacttccgctccctggtcacggccatg
cacagcggagatatcgccattctggccgaggtgaaaaaggccagcccctccaaggggctt
atctgcgctgacttcgatcccgtcgccattgcccgcgcttacgagcagggcggtgccgcc
gccatcagtgtcttgaccgacgagcgcttcttccagggcagcagcccgtatctcagcgcc
gtgcgccaggccgtcagcctgcccgtcctgcgcaaggatttcatcatccacccctcccag
gtctatgaagcagctgccatcggagccgatgccattctgctcatcggcgaagccctggaa
gccccccaggcccaggaactctacgacctggcaagcgaaatcggcctggatgtgctcttt
gaagtccaccaccaggaccagctggtcaaactgcccaccaacttcggcggcctgctgggc
gtcaataaccgcgacctctccaccttccatgtggacttgcagacctccgtcaccatcgcc
cacgctacgggccgggccgtggtctgtgaaagcggcatcggcggacgagacgatattgaa
tccatgacccgtcagggcatccgcatgttcctcatcggcgaatacctcgtcaagcagccg
gaccgcgccgccgccctgcgtcagctcatgggacagagctga

DBGET integrated database retrieval system