KEGG   Desulfurispirillum indicum: Selin_2216Help
Entry
Selin_2216        CDS       T01383                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain-containing protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
din  Desulfurispirillum indicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selin_2216
   00030 Pentose phosphate pathway
    Selin_2216
   00051 Fructose and mannose metabolism
    Selin_2216
   00052 Galactose metabolism
    Selin_2216
   00500 Starch and sucrose metabolism
    Selin_2216
   00520 Amino sugar and nucleotide sugar metabolism
    Selin_2216
  Nucleotide metabolism
   00230 Purine metabolism
    Selin_2216
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Selin_2216
Enzymes [BR:din01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Selin_2216
    5.4.2.8  phosphomannomutase
     Selin_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2445828..2447240
Genome map
AA seq 470 aa AA seqDB search
MNAHIFRANDIRGLAHSELTPQLVSAIGAAFARMLPAKKHPRVFVGKDARTHSETLAHSF
LAGLASVPCEVVYGGDCTSPISYFAASPAGGGFDATVMVTGSHNPPEYNGLKMTLGGRSL
SPDQITTLRLGCGSAVTGTPMVPRVDTSVLVRYREYLCSLFPTLQGMRIGIDCANTTMAL
VAPEVLGCLGAEVHALFTEIDGTFPNHHPDPTIAENLTDLMDLVRQQRLDVGFAYDGDGD
RVGVVLPHPDDGVRILWSDQLLLLFARDMARRYPGRPVTVVSEVKCSQLMYDGINRLPGF
RAIMGKAGHSFIKSRMLDTGALLGGEMSGHIFFADEYLGFDDALYASCRFACLLKQGVDI
WDELREFEQVCSTAELRLESDDQRKVQIVDAVATYLRDPAVRSASGIQDIIDVDGLRICF
GAGAWALLRASNTQPALVMRVEAATPAELERYQCFVEQLIERVSPRVAEA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgctcatatcttccgggccaatgatatccgcggactggcccacagcgaactgacg
ccgcagctggtgtcagcaatcggtgccgcgttcgcgcgtatgcttcccgcgaaaaaacac
ccacgggttttcgtgggcaaggatgcccgtacgcactctgagaccctggctcacagcttt
ctggcaggccttgcctcggttccctgtgaagtcgtctatggtggcgattgcacgtcgccc
atctcctacttcgccgcatcccctgccgggggtggttttgacgccacggttatggttacc
ggcagccacaatcctcctgagtataatggactcaagatgaccctgggtggtcgcagcctc
agtcccgatcagattaccaccctgcgccttggctgcgggagcgccgtgacagggacacca
atggttcccagggttgacacttcggttctggtgcggtaccgggagtatctgtgcagcctc
ttccccacgctgcagggaatgcgtatcggcattgactgcgccaatacgaccatggcactg
gtggcacctgaagtactgggctgtctgggggccgaggttcacgccctctttaccgagatt
gacggcacctttcccaaccatcatcccgaccccaccattgcggaaaatcttaccgacctg
atggatctggtgcgccagcagcggctggatgtcggctttgcctatgatggcgatggagac
cgcgtgggggtggtgctgcctcaccccgatgatggcgtacggattctctggagcgatcag
ctgctgctgctcttcgcccgggatatggcgcgccgttatcccggccggccggttaccgtg
gtcagcgaggtgaaatgctcccagctgatgtatgatggtatcaaccggctgccggggttc
cgggccattatgggcaaagccggccacagctttatcaagagcaggatgcttgataccggg
gccctgctgggtggcgagatgagtggccatatcttctttgccgatgagtacctgggcttt
gacgatgccctgtacgcttcctgtcgatttgcctgcctgctgaagcagggtgttgatatc
tgggacgaactgcgggagtttgagcaggtctgttccacggccgaactgcgtctggaaagt
gatgaccagcggaaagtgcagatcgtggacgcggttgcgacatacctgcgggatccggcg
gtgcgatcagccagtggtatccaggatatcattgatgtggatggtctgcgtatctgtttt
ggcgccggagcctgggcgctgctgagggcaagtaacactcagccagcgctggtgatgcgg
gttgaagctgctacgccagctgagcttgagcgctatcagtgctttgtggagcagctgatt
gagcgggtttctcccagagtggcagaggcctga

DBGET integrated database retrieval system