KEGG   Desulfurispirillum indicum: Selin_2308Help
Entry
Selin_2308        CDS       T01383                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
din  Desulfurispirillum indicum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:din01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:din00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2543300..2544388)
Genome map
AA seq 362 aa AA seqDB search
MSEPQSLDILQELLAIPSVTGDEEAIAAYVERFCREFLPAGQVIRSGNAIIALQPSLNPA
ATETIVLAGHTDTVISPNNFTGKIHEGRLYGLGSSDMKAGDAVMMEIIRAYGRQWAGAYH
LVHVLYDAEEGPYEENGLGPVLEEHGHLFRQALLAICPEPTDNLVQVGCLGTIHATVTFK
GVRAHSARPWLGDNAIYQSTGYLNALAQLQPVDHTFGQLLYREVMHATTTTTNNTKNTIP
DTFAININYRFAPGKSIEQACREIEELAFAHGAASVDFTDLSPAGDVNLENPALQKLIAI
SGQPPQSKQAWTDVARFSLFGLDAVNFGPGQGSMAHKENEYVEIAMVREYERMLLEFLGE
RG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgcaaagccttgatatcctccaggaactgctggccatccccagcgtcacc
ggggacgaggaagccattgccgcctatgtggagcgattctgccgggagttcctgcctgcc
ggacaggttatccgcagcggcaatgccattatcgccctgcagccctcgctgaaccccgcc
gccaccgaaaccattgtgctggcaggccatacggataccgtcatcagccccaacaacttc
accggcaaaattcacgaaggcaggctctatggcctgggcagcagcgacatgaaggccggc
gacgccgtcatgatggagattatccgcgcatatggccgtcagtgggccggcgcgtaccat
ctggtacacgttctctatgacgcggaagaaggcccctacgaagagaacggcctcggcccc
gtgctggaagagcacggccacctctttcgccaggccctgctggccatctgccccgaaccc
accgataacctcgtgcaggtgggctgcctgggcaccattcacgccaccgttaccttcaag
ggcgtgcgcgcccattccgcccgtccctggctgggtgacaacgccatctaccagtccacc
ggctacctcaatgccctggcccagctgcagcccgtggatcacaccttcggccagttgctc
taccgtgaagtgatgcacgccaccacaaccaccaccaacaacaccaaaaacaccattccc
gacaccttcgccatcaacatcaactaccgctttgcccccggcaagagcatcgagcaggcc
tgccgtgaaatcgaagagctggcctttgcccatggagccgccagcgtcgacttcaccgac
ctctcccccgccggtgatgtcaacctggaaaatcccgccctgcaaaagctcatcgccatc
agcggtcagccaccacaatccaaacaggcctggacggacgtggcccgcttcagcctcttt
ggcctcgacgccgtcaacttcggccccggccagggcagtatggcccacaaggaaaacgag
tacgtggaaatagccatggttcgggagtatgagcgcatgctgctggaatttcttggcgag
agaggctga

DBGET integrated database retrieval system