KEGG   Desulfurispirillum indicum: Selin_2308Help
Entry
Selin_2308        CDS       T01383                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
din  Desulfurispirillum indicum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Selin_2308
  Amino acid metabolism
   00300 Lysine biosynthesis
    Selin_2308
Enzymes [BR:din01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Selin_2308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2543300..2544388)
Genome map
AA seq 362 aa AA seqDB search
MSEPQSLDILQELLAIPSVTGDEEAIAAYVERFCREFLPAGQVIRSGNAIIALQPSLNPA
ATETIVLAGHTDTVISPNNFTGKIHEGRLYGLGSSDMKAGDAVMMEIIRAYGRQWAGAYH
LVHVLYDAEEGPYEENGLGPVLEEHGHLFRQALLAICPEPTDNLVQVGCLGTIHATVTFK
GVRAHSARPWLGDNAIYQSTGYLNALAQLQPVDHTFGQLLYREVMHATTTTTNNTKNTIP
DTFAININYRFAPGKSIEQACREIEELAFAHGAASVDFTDLSPAGDVNLENPALQKLIAI
SGQPPQSKQAWTDVARFSLFGLDAVNFGPGQGSMAHKENEYVEIAMVREYERMLLEFLGE
RG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgcaaagccttgatatcctccaggaactgctggccatccccagcgtcacc
ggggacgaggaagccattgccgcctatgtggagcgattctgccgggagttcctgcctgcc
ggacaggttatccgcagcggcaatgccattatcgccctgcagccctcgctgaaccccgcc
gccaccgaaaccattgtgctggcaggccatacggataccgtcatcagccccaacaacttc
accggcaaaattcacgaaggcaggctctatggcctgggcagcagcgacatgaaggccggc
gacgccgtcatgatggagattatccgcgcatatggccgtcagtgggccggcgcgtaccat
ctggtacacgttctctatgacgcggaagaaggcccctacgaagagaacggcctcggcccc
gtgctggaagagcacggccacctctttcgccaggccctgctggccatctgccccgaaccc
accgataacctcgtgcaggtgggctgcctgggcaccattcacgccaccgttaccttcaag
ggcgtgcgcgcccattccgcccgtccctggctgggtgacaacgccatctaccagtccacc
ggctacctcaatgccctggcccagctgcagcccgtggatcacaccttcggccagttgctc
taccgtgaagtgatgcacgccaccacaaccaccaccaacaacaccaaaaacaccattccc
gacaccttcgccatcaacatcaactaccgctttgcccccggcaagagcatcgagcaggcc
tgccgtgaaatcgaagagctggcctttgcccatggagccgccagcgtcgacttcaccgac
ctctcccccgccggtgatgtcaacctggaaaatcccgccctgcaaaagctcatcgccatc
agcggtcagccaccacaatccaaacaggcctggacggacgtggcccgcttcagcctcttt
ggcctcgacgccgtcaacttcggccccggccagggcagtatggcccacaaggaaaacgag
tacgtggaaatagccatggttcgggagtatgagcgcatgctgctggaatttcttggcgag
agaggctga

DBGET integrated database retrieval system