KEGG   Desulfurispirillum indicum: Selin_2405Help
Entry
Selin_2405        CDS       T01383                                 

Definition
nicotinate phosphoribosyltransferase (EC:2.4.2.11)
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
din  Desulfurispirillum indicum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:din00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2660680..2661876)
Genome map
AA seq 398 aa AA seqDB search
MIIQSLLDTDLYKFTMMQVAFHQYPKAHAEYRFFCRTSDADLGGIVEAVRTEVRHLCTLQ
LTAPELDFLASLPYMQPDFLAFLERFRLDERNVSVKACGDANLEIIIRGGILQTILFEIP
LLAIVNELYYQQVFPDPDFRQAWQRLWDKVELVRQHPDGADFHFVEFGTRRRFSRRHHFR
VMEYLRKELPANCVGTSNLHLARTMGLQPVGTMAHEYLQICQVLAPQLQKSQRYAFELWR
REYGDQLGIALSDIITLEAFLRDFDAGLASAYAGARQDSGDPFHWGDSLIAHYQKLGIDP
TTKTLVFSDGLNIPKALEIHRYFRRRIRTLFGIGTNLTNDLGGYTPLDIVIKMTRCNGQP
VAKISDSPGKSICTDPTYIDTLKEAFDVQNHRAGDQNP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgattattcaatcacttctggataccgacctctataaattcaccatgatgcaggtggcc
tttcaccagtatccgaaggcccatgccgagtatcgtttcttctgccgcaccagcgacgca
gatctgggcggcattgtggaagcggtgcgcactgaagttcgccatctgtgcacgctgcag
ctgacggcgccagagcttgacttcctggcctcgctgccctatatgcagccggatttcctg
gcctttctggagcgctttcgcctggatgaaagaaatgtcagtgtcaaggcttgtggagac
gccaatctggaaatcattatccggggcggcattctgcagacgattctcttcgagattccc
ctgctggccattgtcaacgagctgtattaccagcaggtgtttcccgatcccgacttcaga
caggcctggcagcgcctgtgggacaaggtggagctggttcgccagcaccctgacggcgcc
gacttccactttgttgaatttggcacccgccgccgattctcgcgccgccatcacttccgg
gtaatggagtatctgcgcaaggagcttcccgccaactgtgtcggcaccagtaatctccac
ctggcccgcaccatgggtctgcaaccggtgggcaccatggcccatgagtacctgcagata
tgccaggtgctggcgccgcaactgcagaagagccagcgctacgcctttgaactgtggcgg
cgggaatatggggatcagctcggcattgccctgtcggacatcatcaccctggaggctttc
ctgcgggatttcgacgctggtctggccagcgcctacgctggcgcccgccaggattccggc
gatcccttccactggggagacagcctcatcgcccactaccagaaactgggaattgacccc
accacgaagaccctggtcttcagcgacgggctgaacatacccaaggccctggaaattcac
cgctacttccgccgccgtatcagaaccctctttggcatcggtaccaatctcaccaacgac
cttggcggctataccccgctggatatcgtcatcaagatgacccgctgcaatggccagccc
gtcgcgaaaatcagtgactctcccggcaaatccatctgtacggaccccacctatattgat
accctcaaggaagccttcgacgtgcagaaccaccgtgccggagaccagaacccatga

DBGET integrated database retrieval system