KEGG   Desulfurispirillum indicum: Selin_2508Help
Entry
Selin_2508        CDS       T01383                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
din  Desulfurispirillum indicum
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:din00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2783976..2784548)
Genome map
AA seq 190 aa AA seqDB search
MDSIARLMSVGRITYDKDLNSSHSGNISFRASDGSIHITRRGSMLGFLTEGDVIRVEAGG
EHPQASRELPVHRAIYDANPSVGAVVHVHALHATVLSTFHDEILPADAEGRYYLPRIPVL
ECANPIGSDELAAGVSSILQQQHAVIVRSHGVFAAGRDLDEALLYASCTESICRILYMTA
HYQQRSQPCE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggacagtatcgccagactgatgagcgttggcaggatcacctacgacaaggatctcaac
tcgtcacattcaggaaacatctcttttcgagcttccgatggaagcatccatattacccgc
cggggctccatgctgggctttctgaccgaaggggacgtcattcgggtggaggcaggcggg
gagcacccccaggcttcccgcgaactgccggtgcaccgcgccatttacgacgccaacccc
tccgtcggggcagtggtgcacgtacacgccctgcacgccactgtgctctccacctttcac
gatgagatccttccggccgatgccgaagggcgctactacctgccccgcattcccgtgctg
gagtgcgccaaccccatcggctccgacgaactggccgcaggggtatccagcatactgcag
cagcagcacgccgtcatcgtgcgctcccacggcgtcttcgccgccggccgtgatctggac
gaagcgctgctgtacgcctcctgcaccgaaagcatctgccgtattctctacatgaccgcc
cactatcagcaaaggagtcagccatgcgaatag

DBGET integrated database retrieval system