KEGG   Dyella jiangningensis: CH75_21420Help
Entry
CH75_21420        CDS       T03074                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dji  Dyella jiangningensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dji00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CH75_21420
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CH75_21420
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CH75_21420
Enzymes [BR:dji01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CH75_21420
Exosome [BR:dji04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CH75_21420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4686713..4688458
Genome map
AA seq 581 aa AA seqDB search
MPFPFVRAPRMLLLASFPLLTACASQAVTRPAVPVAAIDVPAIQRPDGETPQWWFRNGAA
AAAQLAAQANTGGQHAKNVIVFLGDGMSLPTIAAAHVRAGQLKGVDGESYRLSFERFPFS
ALSRTYETDQQTPDSAGTMTAIMSGVKTRAGFIGVSQVPRRQDCAATRGQELVSTLELAS
AAGMSTGAITTTRITHATPAATYGHLPERNWEVDADLTADAKAQGCKDFAAQLVDFPGAG
GLTVAMGGGRTEFMRAGEDDPVERGMVGQRLDGRDLIGEWKQRHPEGAYVWNRTQLLALD
PAKTPRLLGLFNPSHLNYEHERTTGKLDEPSLAEMTTRAIDVLKQNPNGFFLMVEGGRID
HALHGGNAYRALDETIAFADAVQAALQHTDPSNTLIVVTADHSHTMTFAGYPKRGNDILG
LVKGHTDSYDEEGGAGLARDAAGRPYTTLGFANGPGYTGASDVQPEGSKRFPHNPHDYAY
DTKGRPDLSKVKTSNPDYMQEAILPMKAETHGGEDVAIFATGPGAAAFHGEVEQNAIFHV
IVQHAPLLREELCKLGSCNADGVPVDRPTYEAWLQQVSSRR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttccgttcgtgcgcgcgccacgcatgctgttgctggcctcgtttccgctgctt
accgcctgcgccagccaggctgtcacgcggccggccgtaccggtcgcggccatcgacgtg
ccggcgatccagcgccccgacggcgagacgccgcagtggtggttccgcaacggcgcagcc
gcggccgcacagctcgccgcgcaagcgaacaccggtgggcagcacgccaagaacgtcatc
gtgttcctcggcgacggcatgagcctgccgaccattgcggccgcgcatgtgcgtgcggga
cagctcaagggcgtggatggcgagagttatcgcctgagcttcgagcgctttccgttcagt
gccttgagccgcacctacgagaccgaccagcagacgcccgattccgccggcaccatgacc
gccatcatgagcggcgtgaagacgcgcgcgggtttcatcggtgtctcgcaggtgccgcgt
cgccaggactgcgccgccacgcgcgggcaggaactggtaagcacgctggaactcgcgtcc
gccgcgggcatgagcacgggcgcgatcaccaccacgcgcatcacgcacgccacgcctgcc
gccacctacggccatctgcccgagcgcaactgggaagtggatgccgacctcaccgccgat
gccaaggcgcagggctgcaaggatttcgccgcgcagctggtcgactttcccggcgccggt
gggcttaccgtcgccatgggcggcggccgcaccgagttcatgcgcgcaggcgaggacgac
ccggtcgaacgcggcatggttggtcagcgtttggacggccgcgacctgatcggtgagtgg
aagcagcgccacccggaaggtgcctatgtatggaaccgcacacagctgctggcgctggat
ccggccaagacgccgcgcctgctcggcctgttcaatccctcgcacctcaactacgagcac
gagcgcaccaccggcaagctggacgaacccagtctcgccgagatgaccacgcgcgccatc
gacgtgctcaagcaaaatccgaacggcttcttcctgatggtggagggtggccgcatcgat
catgcgctgcacggcggcaatgcctatcgcgcgcttgacgaaaccatcgccttcgccgat
gcggtgcaggccgcgttgcagcacaccgaccccagcaacaccttgatcgtggtgaccgcc
gatcacagccacaccatgaccttcgccggctatccaaagcgcggcaacgacatcctcggc
ctggtgaagggtcacaccgacagctacgacgaggaaggtggcgccggcctcgctcgcgac
gccgcaggccgcccgtacaccacgctgggcttcgcgaacggcccgggctataccggcgca
agcgatgtgcaaccggaaggcagcaaacgctttccgcataacccgcacgactacgcgtac
gacaccaagggccgccccgacctcagcaaggtgaagaccagcaaccccgattacatgcag
gaggcgatcctgccgatgaaggcggaaacgcatggcggcgaggacgtggcgatcttcgcc
accggaccgggcgccgccgcgttccacggcgaggtggagcagaacgcgatcttccacgtg
atcgtgcagcacgcaccgctattgcgcgaagaactctgcaaactgggcagctgcaacgcc
gatggcgtgccggtggaccggcctacgtacgaggcgtggctgcagcaggtgagttcaagg
cgctga

DBGET integrated database retrieval system