KEGG   Dyella jiangningensis: CH75_23560Help
Entry
CH75_23560        CDS       T03074                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dji  Dyella jiangningensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dji00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CH75_23560
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH75_23560
  Energy metabolism
   00680 Methane metabolism
    CH75_23560
Enzymes [BR:dji01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CH75_23560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5153084..5155789
Genome map
AA seq 901 aa AA seqDB search
MNQHRSPEFAPHDAPLREDVRRLGTLVGNMLAEQISTDFLDEVERIRMAAIERRQENLPL
DALAGLLTGVDTAHAESLARAFATYFQAVNIAERIHRIRRRRDYQREGRAPQPESLLDAF
TRLKAQGVEAGELLEWLERLQVEPVFTAHPTEAVRRSLLEKEQSIVRALVDNFDPTRTPQ
ERKEDDDRIFMALSAGWQTAEASSVSPSVQDEHHHVGFYLANPIYRIVPAVYESLADALQ
AVYGVAVPIPRLLSFATWVGGDMDGNPNVGAATIADSLATQRSHVLEHYIEDLAGLARLL
SQTEDRVEVDSALARRLFDYRVRYPDAAARVRPRHADMPYRSLLTIIGARLDATRDDEHP
EAYTSVRELLDDLHLIAASLIDHRGLHAGAYAVRRLIWRVRTFGFHLARLDVRQDSRMHD
DALALLLDDADWSTRDVADKATQLQPFAGGRQAFAGSEEAAVVALHDVFATLRQSRKRYG
ADALGLYIISMARSAADVLAVLALARYGGLVEQGKVPLDIAPLFETVDDLANAPDTLRAL
LDDPVYREHLASRGGRQWVMLGYSDSGKDGGTLASRWGLQRAQVELLEVAAQFDIRLSFF
HGRGGSASRGGSRIAPALMSSPRGSVAGVLRVTEQGEVIHRKYGIRALALRNLEQTIGAV
LRASLRPRISEAREDVWRERMGKLAACSRQHYRAFVDREGFVDYFRSATPIDVIERMTLG
SRPSRRRSMRGVQDLRAIPWVFAWTQCRSILPGWYGLGTALEFGAAEYGEAAMIEMASDW
PFFANMLDDVAMVLAKSDLGIAEAFSQLAGPLHEPFFGLIRDEFERTHRWLLRLRQSDSL
LQHEPRLAVSIGLRNPYVDPMSLLQVDLLRRWRAGGESDEALLTALVACVNGVSQGLQNT
G
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcaccgcagtcctgagttcgctccgcacgacgcacccctgcgtgaagacgtc
cgccgccttggcaccctggtcggcaacatgctggccgaacagatttccaccgatttcctc
gacgaggtcgagcgcatccgcatggcggcgatcgaacggcggcaggaaaacctgccactc
gatgcgctcgccggtttgctgacaggcgtggacaccgcgcatgccgagtcgctggctcgc
gccttcgcgacgtatttccaggcggtgaacatcgccgaacgcatccatcgcatccgccgc
cgccgcgattaccagcgcgagggccgcgcaccccaacccgaatcactgctggatgccttc
acgcgcctgaaggcgcaaggcgtggaagcgggcgagctgcttgaatggctggaacggttg
caggtcgagccggttttcactgcgcatcccaccgaagcggtgcggcgctcgctgctggag
aaggaacaatcgatcgtgcgcgcgctggtcgacaacttcgatcccacgcgcacgccgcag
gaacgcaaggaagacgacgatcgcatcttcatggcgctgagcgccggctggcagacggcc
gaggcgtcgtcggtcagtcccagcgtgcaggacgaacaccaccacgtcggcttctatctc
gccaaccccatctatcgcatcgtgccggcggtgtatgaatcgctcgccgatgcgttgcag
gcggtgtacggcgttgccgtgcccatcccgcgcctgctcagcttcgccacctgggtgggc
ggcgacatggacggcaaccccaacgtgggcgcggccaccatcgccgacagcctcgccacc
cagcgttcgcacgtgctggagcattacatcgaagacctggcaggcctcgcgcgcctgctc
agccagaccgaggatcgcgtggaggtggacagcgcgctcgcacggcggctgttcgattac
cgcgtgcgttatcccgacgcggctgcacgggttcgcccccgtcatgcggacatgccgtat
cgcagcctgctcaccatcattggcgcgcgactggatgcaacgcgcgacgacgaacacccg
gaagcctatacgtcggtgcgcgagctgctcgacgacctgcacctgatcgcggcgagcctg
atcgatcatcgcggcctgcacgccggcgcgtacgccgtgcgtcgcctgatctggcgcgtg
cgcaccttcggtttccatctggcgcgcctggacgtgcgccaggattcgcgcatgcatgac
gatgcgcttgcgctgctgctcgatgatgcggactggtcgacgcgcgatgtcgccgacaag
gccacgcagctgcagccgttcgccggcggtcggcaggcgttcgcggggagcgaggaagcg
gcggtggtcgcgttgcatgatgtcttcgccacgctgcgccaatcgcgcaagcgttatggc
gcggacgcactggggctctacatcatcagcatggcgcgctcggcggccgacgtacttgcc
gtgctggcgctggcgcgttacggcggactcgtcgaacagggcaaggtgccgctggacatc
gcaccgttgttcgagacggtggacgacctggcgaatgcgcccgacacgctgcgtgcgctg
ctggacgatccggtgtatcgcgaacatctcgcctcgcgcggtgggcgccagtgggtgatg
ctcggctactccgacagcggcaaggatggcggtacgctggcctcgcgatggggcttgcag
cgcgcccaggtcgaactgctcgaagtggccgcgcagttcgacatccgcctgtcgtttttt
catggacgcggtggttcggccagtcgcggcggctcgcgcatcgcgcccgcgctcatgtcg
tctccacgcggttccgtggccggcgtgctgcgtgtcactgagcagggcgaggtcatccat
cgcaagtacggcatccgagcactcgccttgcgaaacctcgagcagaccatcggcgccgta
ctgcgtgcgtcgttgcggccacgcatcagcgaggcgcgcgaggatgtgtggcgcgaacgc
atgggcaagctggcagcgtgtagccggcaacactatcgcgccttcgtcgaccgcgaaggc
ttcgttgactacttccgctcggccacgcctatcgacgtgatcgaacgcatgacgctcggt
tcacgcccgtcgcgtcgacgcagcatgcgcggcgtacaggatctgcgcgccattccatgg
gtgttcgcatggacgcaatgccgttcgatcctgcctggctggtatggcctgggcaccgcg
ctcgagtttggagcggcagagtacggcgaggccgcgatgatcgagatggccagcgactgg
ccgttcttcgccaacatgctcgacgacgtggcgatggtgctggccaagagcgatctcggt
atcgccgaagcgttctcgcagttggccggtccgctgcacgagcctttcttcggcctgatc
cgcgacgaattcgagcggacgcatcgctggctgctgcgcctgaggcaaagcgatagcctg
ctgcagcatgagccgcgattggccgtgtcgatcggactgcgcaatccctatgtcgatccg
atgagtctgttgcaggtggatctgttgaggcgctggcgcgcgggcggcgaaagcgatgaa
gcgctgctcacggcgctggtggcctgcgtcaatggtgtatcgcaggggttgcagaacacg
ggttga

DBGET integrated database retrieval system