KEGG   Desulfurococcus kamchatkensis: DKAM_0053Help
Entry
DKAM_0053         CDS       T00817                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DKAM_0053
Enzymes [BR:dka01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     DKAM_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
49298..50176
Genome map
AA seq 292 aa AA seqDB search
MVVNMNWRLLLQGSVKFACMESSSNIGVLIGVPMDYTSTYKPGSRFAPDYIRNASCNIEF
YSLSTRRIMESEGFIDLGNIILPPGDVEKSLSIIQSVAKGAWREYQGIPLGFLGGEHLIT
YPIVSGLMDGIDTLVVFDAHLDLRDEYLGSRLNHASFLRRLVEKGVRVIHIGSRAYSGEE
LEYLKTLENIKVYSVLDVLEKTVEAVELGRVYISIDMDVIDPSYAPGVGNPEPFGLTPLQ
LLGLLKKIVGSSSRLVGFDIVEVNPLVDVNDVTSILAGKLVFELAALARGGR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtgaacatgaattggaggctactactacagggatcagtgaagtttgcctgtatg
gagtccagcagtaatataggggtattaatcggtgtgcccatggattacacatcaacatat
aagcctggttcaagattcgcaccggactatataaggaacgcatcatgtaacattgagttc
tatagtttgtcaactaggagaatcatggagagcgagggtttcatcgacttgggaaacatt
atcctgccacccggagatgtagagaaatccctatcaataatacaaagtgttgccaagggg
gcttggagggagtaccaggggatacccctcggtttcttaggaggggaacacttaatcacc
tacccaattgtaagcgggctaatggacggcattgacaccctagtggtttttgatgcgcat
ctcgatctaagggatgaatacctcggctcaagattgaatcacgcatcattccttagaaga
ctcgttgagaaaggtgtgagagttatacatataggctccagggcctacagtggtgaggag
ttggagtacttgaaaaccttggaaaatatcaaggtatactcagttctagacgttcttgaa
aaaacagtggaagcagtggagttagggagggtatatataagcatagatatggacgttatt
gatccatcatatgcgcctggcgtggggaacccggagcccttcgggttaacccccctacaa
ttacttggactattaaagaaaatagtggggtcgtcgagccgcctggtaggatttgatata
gttgaagtaaacccgctggtcgatgtaaacgatgttacaagtatactggctggtaaacta
gtatttgagctagctgcattagccaggggtgggagatag

DBGET integrated database retrieval system