KEGG   Desulfurococcus kamchatkensis: DKAM_0125Help
Entry
DKAM_0125         CDS       T00817                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dka  Desulfurococcus kamchatkensis
Brite
Enzymes [BR:dka01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DKAM_0125
Transfer RNA biogenesis [BR:dka03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    DKAM_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(112553..114028)
Genome map
AA seq 491 aa AA seqDB search
MVSHPHPLKPELMSAMLNIQVRKPSRMLSGITVVAVMTHPLPCPGECVYCPGGLGYNAPK
SYFGNEPAVRRARRNQFHPFKQVYERLRQYEALGHNPSKLEVIIMGGTFLALPESYKKWF
IANIYEACNTYPYGSPPLRVDLESAILRNETSRYRVVGLTIETRPDYGRERHADEMLHYG
ATKVELGVQSIYDDVLEIVRRGHSVKDTIESTRILRDAGFKICYHIMLGLPGSNPDRDLE
MVKELFTNPDFRPDMLKIYPTEVIEGTTLYTWWKEGKYKPYSDEDVIELVSEMYRYIPKY
VRVMRIRRDIPADEVAAGTRYANLREMIEKSAIEKGIEIQEIRFREAGLQMYKYGKTPDP
SRTNITRLTYEAGGGIEEFLAVEDTASNILIGFLRMRVPSEKAHRWEIDRDTAIIRELHI
YGPETPVGEKGIWFQHVGWGRKLVEKAEDIALNKYGVKKILVISGVGAREYYRRLGYFHP
PESPYMFKYLK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtttcacacccccatccattaaagccggagttgatgtctgcaatgctgaatatacag
gttagaaagccatctagaatgctgagcggtataacagttgtagctgttatgacgcatccc
ctaccctgcccaggcgaatgcgtttattgcccaggtggactgggatataatgccccgaaa
agctattttgggaatgaaccagcagtgagaagggctaggagaaaccagttccacccgttt
aaacaggtatacgagaggttgaggcagtacgaggcactcggccataatccaagtaagtta
gaggtaataatcatggggggcaccttcctagccctcccggaatcctataagaaatggttt
atcgcaaacatatatgaggcatgtaatacctatccctatggaagcccacctttaagagtc
gacctagagtcagctatcctaagaaacgagaccagcaggtatagagttgtaggattaaca
atagagacaaggcctgattatggaagagaaagacatgcagatgaaatgctgcactatggg
gctacaaaggtcgagctaggtgttcaatcaatatatgatgatgtattagaaatagtgagg
agagggcatagtgtaaaggatacaatagagtcaacacgaatacttagagatgccggcttc
aaaatatgctaccacataatgctcggtctaccaggtagcaatcctgaccgggatctagaa
atggttaaagaactattcaccaatcccgattttagaccggatatgctgaagatctacccc
accgaggtaatagagggaacaaccctctatacttggtggaaagagggaaaatataaacca
tacagcgatgaagacgttatagaattagtcagcgaaatgtaccgttacatacctaagtac
gttagagtaatgagaatacgcagggatatcccagcagatgaagtggctgctggaacaaga
tacgctaatctaagagagatgatcgaaaagagtgctattgagaaaggtatagaaatacag
gagataaggtttagagaggccgggctccaaatgtataaatacggtaaaacccctgatccc
agtagaaccaatataaccaggctgacatatgaggccggtgggggtatcgaggaattccta
gccgtggaggacacggcttcaaatatattaataggcttcctaagaatgcgcgtgccaagc
gagaaagcccatagatgggagatagacagagatactgctattataagagaactacatatc
tatggccctgaaacacctgtaggagagaaaggtatatggttccaacacgtagggtggggt
aggaaattagttgagaaagctgaggatatcgccctgaataaatatggggttaagaaaata
ctcgtgataagcggtgtcggcgccagggagtactataggagactagggtatttccaccca
ccggaaagcccatacatgttcaaatatcttaagtaa

DBGET integrated database retrieval system