KEGG   Desulfurococcus kamchatkensis: DKAM_0158Help
Entry
DKAM_0158         CDS       T00817                                 

Definition
AMP phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DKAM_0158
Enzymes [BR:dka01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     DKAM_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144911..146440
Genome map
AA seq 509 aa AA seqDB search
MGFESKSKLFNVKIIDLDIHRNLIIMNSGDAEELGVVTNNIVLVTAGDYSAYAMVITSRT
VTQPGVVALSTQTASTLRVSEGDMVGVKPIGLPASFNALKKRISGVKLSESEMKSIIQDV
VNGIYGEAEIAAFLISQLYNELSEEELSYLVKAMVETGSKLIFEETVYDVHSIGGVPGNS
KVALITVPIVAASGLLIPKTSSRAITSPAGTADTMEVLARVDLTIDEIVEIARKVKGVLA
WGGRLNLAPADDIFVNIERRLSIDPEQQMVASILSKKLAMGVERLVIDIPVGRGAKVEKV
SLAEKLAGLFIRQAGLLGVAMRVALTYGGQPIGTSVGPALEAREALEALIERKGSRSLID
KAILLAGLVMELSGRVQPGQGEEVAREIFVSGKAYEKFKQIIEAQGGNPETKPSDIPIGS
HTYTLTSPLEGAVTHIDNTAISLIAKACGAPYDKRAGVKLHAKVGYRVNKGDPLITLYSD
SASRLETAVRLLRDLQPVIVEGMLLRTLP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggggtttgagagtaagtctaagctatttaatgtaaaaataattgacctggatatacat
aggaatttaattataatgaatagtggtgatgctgaggaattaggtgtagttacaaacaac
attgttttagttactgctggagactactcggcttacgcaatggttataactagtaggacg
gttactcaacccggtgtagtagctttatcaacgcagacggcttcgacgctaagggtttca
gaaggagatatggttggtgttaaacccattgggttaccggctagcttcaatgcgttaaag
aagaggataagtggtgttaagctctctgagagcgagatgaagagtattatacaggatgtt
gtgaacgggatctatggcgaggctgagatagcggctttcctcattagtcagctctacaat
gagttaagcgaggaggaattaagctatcttgttaaagcaatggttgaaacgggaagtaaa
ctcatatttgaggagacggtatacgatgtgcatagtattggaggggtacctggtaatagt
aaggtggctttgataacagtaccaatagttgccgcttcagggttattaatacctaaaacc
agtagtagagccataacgagcccggctggcacagctgatactatggaggtcttagctagg
gttgatctaacgatcgatgagatagttgagatagctaggaaggttaaaggcgttttagcc
tggggaggtaggcttaatctggctccagcggacgatatatttgttaatattgagagaagg
ctctccatagatcccgagcaacaaatggttgcaagtatattatccaaaaagctcgctatg
ggtgtggagagactagtgatagatataccagtggggcgtggggcaaaggttgaaaaggtt
tctcttgctgaaaaattggcaggattattcataaggcaagccggtttactaggggttgca
atgagggtcgccttaacctatggtgggcaacccataggtacatcggttggcccggcccta
gaggcgagagaagctctagaagcccttattgagagaaagggaagcaggagccttattgat
aaagccatactcctagctggattagttatggagttaagcgggagggttcagcctgggcag
ggtgaggaggtggctagggagatattcgtatccggtaaggcatatgagaagttcaagcag
ataatagaggctcaaggagggaaccctgagaccaagccaagcgatatacccataggctct
cacacatatactctcacctcaccgcttgagggagctgttacacatatagataacactgct
atctctctaatagctaaggcgtgtggagccccctatgataaaagagctggcgtgaaactc
catgcaaaggtaggctacagagttaacaagggtgatccattaataacgttatatagtgac
agcgcgtcaagacttgagacagctgtgaggcttctaagagacctacagccagtgatagtt
gaggggatgcttttaaggactctgccatag

DBGET integrated database retrieval system