KEGG   Desulfurococcus kamchatkensis: DKAM_0213Help
Entry
DKAM_0213         CDS       T00817                                 

Definition
molybdenum cofactor biosynthesis protein C
Orthology
K03637  
cyclic pyranopterin phosphate synthase [EC:4.1.99.18]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DKAM_0213
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    DKAM_0213
Enzymes [BR:dka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.18  cyclic pyranopterin phosphate synthase
     DKAM_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(198662..199090)
Genome map
AA seq 142 aa AA seqDB search
MADITGKEDVYREATATGYIKLKPSTIEIIKKGLVEKGDVFSVSTIAAIMSVKETPRILP
LTHNIPITNVKVDFEVLDDGIRVYITVKTTARTGVEMEALTGAAIALLNIWDMVKKYEKN
EDGQYPYTVITDLRVVEKKKGV
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggctgatataaccgggaaggaggacgtgtacagggaggcaacggcgacaggctatata
aaacttaagccttcaaccatagaaattattaaaaaagggcttgttgagaagggagacgtg
ttttcagtgtcaacaatagcagctataatgagtgttaaggagacacctagaatactgcct
ttaacacataacatccccataacaaatgtcaaagttgatttcgaggtactcgatgacggc
ataagagtctatataacagttaagacaacggctaggacaggggtggaaatggaggcttta
acaggtgcggccatagcattactgaacatatgggatatggttaagaaatacgagaagaat
gaagacgggcaatacccatatacggttataactgatctcagagtcgtagagaagaagaaa
ggggtgtag

DBGET integrated database retrieval system