KEGG   Desulfurococcus kamchatkensis: DKAM_0213Help
Entry
DKAM_0213         CDS       T00817                                 

Definition
molybdenum cofactor biosynthesis protein C
Orthology
K03637  
molybdenum cofactor biosynthesis protein C
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dka00790]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:dka04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(198662..199090)
Genome map
AA seq 142 aa AA seqDB search
MADITGKEDVYREATATGYIKLKPSTIEIIKKGLVEKGDVFSVSTIAAIMSVKETPRILP
LTHNIPITNVKVDFEVLDDGIRVYITVKTTARTGVEMEALTGAAIALLNIWDMVKKYEKN
EDGQYPYTVITDLRVVEKKKGV
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggctgatataaccgggaaggaggacgtgtacagggaggcaacggcgacaggctatata
aaacttaagccttcaaccatagaaattattaaaaaagggcttgttgagaagggagacgtg
ttttcagtgtcaacaatagcagctataatgagtgttaaggagacacctagaatactgcct
ttaacacataacatccccataacaaatgtcaaagttgatttcgaggtactcgatgacggc
ataagagtctatataacagttaagacaacggctaggacaggggtggaaatggaggcttta
acaggtgcggccatagcattactgaacatatgggatatggttaagaaatacgagaagaat
gaagacgggcaatacccatatacggttataactgatctcagagtcgtagagaagaagaaa
ggggtgtag

DBGET integrated database retrieval system