KEGG   Desulfurococcus kamchatkensis: DKAM_0402Help
Entry
DKAM_0402         CDS       T00817                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DKAM_0402
Enzymes [BR:dka01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     DKAM_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373592..376519
Genome map
AA seq 975 aa AA seqDB search
MTLLCGEIHYFRVPKHLWRDRLLKLKRAGGNCVSTYIPWNWHGPREKVVDFTDGTSQWHV
ASYYSRDLASFLELAGELGLRVIARPGPYICSEWDSGGHPNWIYTKAMRLRSLDPGYFKH
VVEWYNSVLNILKPYVEREIVIGIQVENEYFWGNEKYIEKLAEIVEEKLPGVLVFTNEDP
YLTRIPNTIDLYPSPWDMRQFDDRLRSYLSSQPGLFKMIMELEGGWFKSSRYGYYPTNRL
SIPPEWTEILLKTAVGMGLNNINIYMFHGGSNPGYYTAKYLASSYDFEACIREWGELSER
YYRVKRVFTFLNGFQELVTSLKPGETVKTASTCSELLQRVGDHGKIAVLRNTGDNLCYQR
LINRGEIIPMWTPIRVPPRYAKIVLLDLVVEGTPFKLVYTSGEALLMKRLGDTVVMIIYG
DHGEYTETAVEVEGGVLDVDIQGDVLIRREGERAYLVVNHTHGEHLAIVKSTRGQNLLLI
FTCRCRAEKTWIVDEDLVLISNIYYIGDSRIDGGKVVINAELDEDSCGRLLVVTSREIEA
ISLEDLDLDLTRLSKYVYATHIPLSMCRSGKNTYHPLEYRLLEDPVFHTLTSINPSSPLE
KNGFYENGIYVYRLRLHLDKKQLGDLLDRHLALIGFSDYAVVSINNEYAGSGYHYIEMSA
DSLREGVNEVTVILESTGHPNDGLLYVPNGIYGGVYLGRVGEIRLYKWRKTGFEISYGPG
FDLAEFIANPEPVIKALQEQRSSTGETYSVGSPGLYITEFKVDDLSRHYVLDPGLEFYYN
HYYRILLFVNKVYVGPLIGPIDITRYLKPGVNEVALLVEWGVVNPVIGVYQYKVDGEWFI
QEGLHGLIEEWFRRSPRGETAEPPILLGDKAGRVIWVNTVIPYEKEPTSSSPVKLEVDFW
GCRILVFVNGEFIGRISDDSPERELYVPETAVRRGLNNITLLAIVTSRSSGIRGLRLKET
YVHERKEIVFKLGLT
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgaccctactctgtggtgaaatacattattttagggttccaaagcatctctggagagat
aggctcctaaagttgaagcgggctgggggaaactgtgtatccacttatataccgtggaat
tggcatggcccgcgggaaaaagttgtggatttcaccgatggaacgagtcagtggcatgta
gcgagctactatagtagagatttggcttcatttctcgagttggctggagaactcggttta
agagttatagcgaggcccggcccctacatatgttctgaatgggatagtggcggccatcca
aactggatctatactaaagcgatgaggctacgctcgctggaccccgggtactttaagcat
gtggtggaatggtataatagtgtcctcaacattctcaaaccatacgtggagagagagatt
gtaattggtatccaggttgagaacgagtatttctggggtaatgagaagtatattgagaag
ctagcggagatcgtggaggagaagctacccggtgtactggtgttcactaatgaagacccg
tatttaacgaggataccgaacacaatagacctatacccttctccctgggatatgaggcaa
ttcgatgataggctacggagctacttgtcatcgcaacccgggttattcaagatgatcatg
gagctcgagggaggctggtttaagtcgtctaggtatggatactatccaacaaataggctg
agtattccacctgagtggacggagatattgttgaaaaccgctgttgggatgggccttaat
aatataaatatatatatgtttcacggagggtcgaatccaggctactacaccgctaagtac
ctggcttcatcatatgattttgaagcatgtattagagagtggggagagctctcggagaga
tattatagagtgaagagggtgtttaccttcctcaatgggttccaggagttggtgactagt
ttaaagccaggtgaaaccgtgaaaaccgcgtctacttgtagtgaattattacagcgtgta
ggtgatcacgggaaaatagcagtactgagaaataccggtgacaacctatgctaccagagg
cttataaacaggggcgaaataatacccatgtggacgcctatacgtgtgccaccgcggtac
gctaaaatagttctactagacctcgtcgtagaagggacgcctttcaaactcgtgtacacg
agtggagaggcattattaatgaaaagactaggagacaccgtggtcatgattatttacgga
gaccacggtgaatacactgagacagctgtagaagtagagggtggagtactcgatgtagat
atacagggagacgtgttgatccgtagagagggtgagagagcatacctggtggttaaccat
acacacggtgaacacttagccattgtgaagtcaacgagggggcaaaacctactattaatc
ttcacatgtaggtgtagagctgagaaaacatggattgtagatgaagacctcgtactcata
tccaacatctactacataggtgactcaaggatagatgggggcaaggtggtgattaacgct
gaactcgacgaagacagctgtggaagattgctagtagttacttcacgtgaaatagaggcg
atcagtcttgaagacctggacctagatttaacaaggctctccaagtatgtctatgccaca
catattccattaagtatgtgtcggagcgggaaaaacacctaccaccccttagaatacagg
cttctagaagaccctgtattccacacgttaactagtattaatccttcgagcccgctggaa
aagaacggcttctatgaaaacggtatctatgtgtacaggctaaggcttcaccttgataag
aagcaactaggggatctattagacaggcatctcgcgctgatcggtttcagcgactatgct
gttgtatccatcaataacgaatatgctggatcaggctaccactacatagagatgtctgca
gactcccttagggaaggcgtgaacgaagtaacagttatactggagtccacgggtcaccct
aatgatggcttattatatgttccaaacggcatatatggtggagtctaccttggtagagta
ggcgagatcaggctctacaagtggagaaaaacagggttcgagatatcatatgggccaggc
ttcgacctcgcggaattcatcgccaacccggaaccagtgattaaggccctacaagaacag
aggagtagtacaggggaaacatacagcgtcggctccccaggcctttatataacagagttc
aaagtagatgatttatccaggcactatgtgttggatccaggcctagaattctactacaac
cattactatagaatcctcttattcgtgaacaaagtatacgtcggccccctcataggccct
atcgatataacaaggtatctcaaacccggggtaaacgaggtagcattactcgttgaatgg
ggcgtggtaaacccagtcataggggtctaccagtacaaggtggatggtgaatggtttata
caagaaggcctccatggattaattgaggaatggtttagaagaagcccacgcggcgagaca
gctgaaccccctatattacttggggataaagcaggacgtgttatatgggtcaacactgtg
attccatatgagaaggagccaacgagctcctcaccagtgaaactggaagtggatttctgg
ggatgtagaatactggtgtttgtaaacggggaattcataggtaggattagcgatgactct
ccagaaagggagctatatgttccagagacagctgtgagaaggggtttaaacaatattaca
ctacttgctatagttacatcaaggagctctggtataaggggactgcgtctgaaagaaaca
tacgtgcatgagagaaaagaaattgtttttaaactaggcttaacctag

DBGET integrated database retrieval system