KEGG   Desulfurococcus kamchatkensis: DKAM_0578Help
Entry
DKAM_0578         CDS       T00817                                 

Definition
Pyruvate synthase subunit porB
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DKAM_0578
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_0578
   00020 Citrate cycle (TCA cycle)
    DKAM_0578
   00620 Pyruvate metabolism
    DKAM_0578
   00640 Propanoate metabolism
    DKAM_0578
   00650 Butanoate metabolism
    DKAM_0578
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DKAM_0578
   00680 Methane metabolism
    DKAM_0578
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DKAM_0578
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DKAM_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(539824..540882)
Genome map
AA seq 352 aa AA seqDB search
MTVQTLPEFPVKKGEPAYKVWIFEPGWKGEIPLNFNLRQLAEQKRPVLLPGHRLCAGCTA
PLVVKLASFALRGPTIFVNATGCLEVATTIFPYTSWAAPWIHVAFENAAAVAGGVESAIK
ALKKTGRLPYDHVDVIVFAGDGGTFDIGFQALSGMAERGHDVLYILYDNEAYMNTGIQRS
GGTPQFASTTTSPAGEVIPGKTQAKKPIADIMVAHRIPYVATATPAHWTDFMKKVRRGLE
VNGPAFIHALSDCNRGWRHETDISVEIMRRAVDTCYFPLWEWTPEQGYMLTDRSLAIARN
PALKQPIEKYIEVQGRFRHLLKPENKELLKQFQEYVDKVWEDLLRRASNAPK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacggttcaaactctgccagaattccctgttaaaaagggtgagccagcatacaaggta
tggattttcgaaccgggttggaagggcgagataccgttaaacttcaacctcaggcaactg
gctgaacaaaagaggccggtgctattacctggtcacaggctatgtgctggatgtactgca
ccattggtagtaaagctagctagctttgctctcagaggtccaacgatattcgttaacgcc
accgggtgtctcgaggtagcaaccacgatatttccctatacaagctgggctgctccatgg
atccacgtagcattcgagaacgctgcggctgttgccggaggcgttgaatcagcgattaag
gcattgaagaaaaccgggaggttaccttatgatcacgtggatgttatagtgtttgctggt
gatggaggaacctttgacataggattccaggctttaagcggtatggctgaaaggggccac
gacgtattatacatactctacgataatgaggcctacatgaacactggtatacagagatcc
ggtggaaccccgcaattcgcgtcaacaactacatcaccagccggtgaagtgataccaggt
aaaacacaggctaagaagccgatagccgatataatggtggcccatagaataccatatgtt
gctacagctacgccagcccactggacggatttcatgaagaaggttagaaggggcttagag
gttaatggtccggcattcatccatgcattaagtgattgtaaccgtggatggaggcatgaa
acagatatatcagtagagataatgaggagagcggttgatacatgctacttcccattatgg
gagtggacacctgagcagggatatatgttgacagataggagtctagcgatagctaggaac
ccggctttaaagcaacccatcgaaaaatacatcgaggtccaaggtaggttcagacaccta
ttaaagccggagaacaaggagctattaaagcaattccaggaatacgttgacaaagtatgg
gaagacctcttaagaagggctagtaatgcaccaaagtag

DBGET integrated database retrieval system