KEGG   Desulfurococcus amylolyticus 1221n: DKAM_0578Help
Entry
DKAM_0578         CDS       T00817                                 

Definition
(GenBank) Pyruvate synthase subunit porB
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00010  Glycolysis / Gluconeogenesis
dka00020  Citrate cycle (TCA cycle)
dka00620  Pyruvate metabolism
dka00640  Propanoate metabolism
dka00650  Butanoate metabolism
dka00680  Methane metabolism
dka00720  Carbon fixation pathways in prokaryotes
dka01100  Metabolic pathways
dka01120  Microbial metabolism in diverse environments
dka01130  Biosynthesis of antibiotics
dka01200  Carbon metabolism
Module
dka_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_0578
   00020 Citrate cycle (TCA cycle)
    DKAM_0578
   00620 Pyruvate metabolism
    DKAM_0578
   00640 Propanoate metabolism
    DKAM_0578
   00650 Butanoate metabolism
    DKAM_0578
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DKAM_0578
   00680 Methane metabolism
    DKAM_0578
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DKAM_0578
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DKAM_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACL10904
UniProt: B8D473
Position
complement(539824..540882)
Genome map
AA seq 352 aa AA seqDB search
MTVQTLPEFPVKKGEPAYKVWIFEPGWKGEIPLNFNLRQLAEQKRPVLLPGHRLCAGCTA
PLVVKLASFALRGPTIFVNATGCLEVATTIFPYTSWAAPWIHVAFENAAAVAGGVESAIK
ALKKTGRLPYDHVDVIVFAGDGGTFDIGFQALSGMAERGHDVLYILYDNEAYMNTGIQRS
GGTPQFASTTTSPAGEVIPGKTQAKKPIADIMVAHRIPYVATATPAHWTDFMKKVRRGLE
VNGPAFIHALSDCNRGWRHETDISVEIMRRAVDTCYFPLWEWTPEQGYMLTDRSLAIARN
PALKQPIEKYIEVQGRFRHLLKPENKELLKQFQEYVDKVWEDLLRRASNAPK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacggttcaaactctgccagaattccctgttaaaaagggtgagccagcatacaaggta
tggattttcgaaccgggttggaagggcgagataccgttaaacttcaacctcaggcaactg
gctgaacaaaagaggccggtgctattacctggtcacaggctatgtgctggatgtactgca
ccattggtagtaaagctagctagctttgctctcagaggtccaacgatattcgttaacgcc
accgggtgtctcgaggtagcaaccacgatatttccctatacaagctgggctgctccatgg
atccacgtagcattcgagaacgctgcggctgttgccggaggcgttgaatcagcgattaag
gcattgaagaaaaccgggaggttaccttatgatcacgtggatgttatagtgtttgctggt
gatggaggaacctttgacataggattccaggctttaagcggtatggctgaaaggggccac
gacgtattatacatactctacgataatgaggcctacatgaacactggtatacagagatcc
ggtggaaccccgcaattcgcgtcaacaactacatcaccagccggtgaagtgataccaggt
aaaacacaggctaagaagccgatagccgatataatggtggcccatagaataccatatgtt
gctacagctacgccagcccactggacggatttcatgaagaaggttagaaggggcttagag
gttaatggtccggcattcatccatgcattaagtgattgtaaccgtggatggaggcatgaa
acagatatatcagtagagataatgaggagagcggttgatacatgctacttcccattatgg
gagtggacacctgagcagggatatatgttgacagataggagtctagcgatagctaggaac
ccggctttaaagcaacccatcgaaaaatacatcgaggtccaaggtaggttcagacaccta
ttaaagccggagaacaaggagctattaaagcaattccaggaatacgttgacaaagtatgg
gaagacctcttaagaagggctagtaatgcaccaaagtag

DBGET integrated database retrieval system