KEGG   Desulfurococcus kamchatkensis: DKAM_0589Help
Entry
DKAM_0589         CDS       T00817                                 

Definition
(GenBank) Aminopeptidase from family M42
Organism
dka  Desulfurococcus kamchatkensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(550849..551958)
Genome map
AA seq 369 aa AA seqDB search
MNTLEWRGQYIELIKKLTSLHAPSGREDPVKDLVAELMKSHVDKLWIDVWGNVVGYRKGS
KGSGKIMIAAHMDEIGLFISHIEDDGFLRVIPIGGVLERTLLYQRVVVRTRDGRLYRGVI
GLKPPHVIKPEEAQKVPELRELFIDVGASSKEEVEKMGIRVGDIAVFDREVAELGWNRIT
GKAFDDRVGVVVMLKALEMLEKHDVDVYFVATVQEEVGLKGAKTSAYGISPDVALAIDVT
IASDVPGVAKSEWFTRLGYGPAIKIVDGRNAGGLIAHPKVVEFLVSIAEKKRIPYQLDVI
SGGTTDASTIALNKEGVAAGTISIPSRYIHSPVEVVDLRDLYNASLLAKAFIEEATPEWI
QSIKGVVIK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaccttggaatggaggggccagtacatagagttaattaagaagctaaccagcctt
catgctcctagtggaagagaagacccggtgaaagacctcgttgccgagttgatgaagtct
catgtagataaactatggatagacgtatgggggaacgtagttggatataggaagggctct
aagggctctggtaaaatcatgatcgcagcccacatggatgaaatagggttattcatctct
cacatcgaggatgacgggtttctaagggttatacccataggtggagtactcgagaggact
cttctctaccaaagagtagttgttaggacgagggatgggagactatacaggggtgtgata
gggttaaagcctcctcatgtaattaagccggaggaagcccagaaagtaccggagctacgg
gaactcttcatagatgttggtgcgtcatcaaaggaggaagtggagaagatgggtataaga
gtcggcgatatagctgtatttgatagagaggtagctgagttaggctggaacaggataacc
ggtaaggcgttcgatgacagggttggcgtcgtggttatgttaaaggctcttgaaatgctt
gagaaacacgatgtagacgtttatttcgttgcaacagtccaggaggaagtagggttgaag
ggggctaagacgtcggcttacggtatctcaccggatgtggcattagcgatagatgtaacc
atagcaagcgatgtaccaggagtagctaaaagcgagtggttcactcggctaggatatggt
ccagctataaagatagttgatgggagaaatgcaggtgggttgatagcgcatccaaaggtg
gttgagttcctggtgagcattgccgagaaaaagaggataccttatcaattagatgtgatc
tcaggtggtacaaccgatgcctcaacaatagctttaaacaaggagggtgttgctgctgga
acgatctctattccctcaaggtatatacatagccctgttgaagtagtggatttaagagac
ctctacaatgcatcattactagctaaggccttcatagaggaggcaacgcctgagtggatt
caaagcataaagggagtagtaataaaataa

DBGET integrated database retrieval system