KEGG   Desulfurococcus amylolyticus 1221n: DKAM_0614Help
Entry
DKAM_0614         CDS       T00817                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00260  Glycine, serine and threonine metabolism
dka00750  Vitamin B6 metabolism
dka01100  Metabolic pathways
dka01110  Biosynthesis of secondary metabolites
dka01120  Microbial metabolism in diverse environments
dka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DKAM_0614
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DKAM_0614
Enzymes [BR:dka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DKAM_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACL10940
UniProt: B8D4A9
Position
complement(581054..582322)
Genome map
AA seq 422 aa AA seqDB search
MYVRELKCSRCGRRLLLSEKPLTCPSKDLGRLDIVYDYEAIAESINRDILSQRSFNMWRY
MEFLPVPSRDYIVSLGEGGTPLLKARRLGEKLGLRNLYLKDETRNPTGSFKDRAMSVSVS
MAVYFGFKKAVIASSGNAAASLAAYGAKAGIEVYAFVPDFAGYGKIAQLLYYGAKVFKVR
WSEAEDPTVKMMRILYEEHGFYPSPSFGVFNPYQVEGPKTISMEIVEQLKWIVPDQVFVP
TGAASLLTGVFNGFRDFNMVGWINRYPKLVAVQPEGNHPFVRAWRERADPMNIRPWEKPP
DTIATGLEDTYPWDGDAGLKALYTTNGYGVVVSDKEILDSMKMLASLEGVFAEPSGAAGL
AGLIKAIEEKQVDRDEVIVVLVTGHGLKDPDIIRKTAGEPPLINPNVEEFRKTAREFYGV
LA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgtatgtaagagaattgaagtgtagtaggtgtggtagaagactacttctaagcgagaaa
ccattgacatgccccagcaaggatctgggtaggctagatatagtgtatgactatgaagcg
atagctgagagcattaatagagatattctctcacaaagatcattcaacatgtggagatac
atggaattcctcccagtgccaagcagagactatattgtctcacttggtgaagggggtacc
cccctactaaaggcgaggagacttggagagaagttgggcctgagaaacctgtatcttaag
gatgaaacaaggaacccaactgggagctttaaggatagagcaatgagcgtgtctgtgtcc
atggccgtgtacttcggcttcaagaaggcagtgatcgctagcagtggtaatgcagccgca
tctctagcagcctatggggctaaagccggtatagaagtctatgcatttgtccctgatttc
gctggctatggtaaaatagcccaattactctattatggagccaaagtatttaaggttaga
tggagtgaagcagaggatcccacggttaaaatgatgcgtatcctctatgaggaacacggc
ttctacccgagtccaagcttcggcgtcttcaacccataccaggtggagggacctaagacc
atctctatggaaatagtagagcaattgaaatggatagttccggatcaagtttttgtacca
accggtgcagccagcctattaaccggggtcttcaacgggttcagggacttcaatatggtt
ggatggataaaccggtatcctaagctagtagctgtacagcccgagggaaatcaccccttt
gtaagggcttggagagaaagggctgatccgatgaatatacgtccctgggagaagccgccg
gatacaatagctaccgggctagaagacacttatccatgggatggcgatgccggattaaag
gccttatacaccaccaatggttacggtgtagttgtaagcgataaggaaatactggattca
atgaagatgctggctagtcttgaaggcgtattcgctgagccaagtggtgcagccggttta
gccggcctaataaaggctattgaggagaaacaggtggatagggatgaagtaatcgtggta
ctagtcacaggacacggcctaaaggatcctgatataattaggaaaacagccggggaaccc
ccattaataaacccaaatgttgaggaattcaggaagactgcccgcgaattctatggtgtt
ttagcctag

DBGET integrated database retrieval system