KEGG   Desulfurococcus kamchatkensis: DKAM_0742Help
Entry
DKAM_0742         CDS       T00817                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DKAM_0742
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DKAM_0742
Enzymes [BR:dka01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     DKAM_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712864..713787
Genome map
AA seq 307 aa AA seqDB search
MYKGMDVISALQFSRSDVEKLITIAEELRRRVENGEKLELAKGRILFTAFFEPSTRTRLS
FQFAMAKLGGNVIDLGPEEVTSRAKGESPEDTLRTVDSYDPDIIVVRHREPGFAAKAAEI
CRAPVVNAGDGYNEHPTQALLDVYTIWRSLGRIDGVTIGIMGDLKYGRTISSLSYILSNF
RDVTIYFISPQALRPREEVLKILDQRRTRYELLEKPDDAMEKLNILYVTRLQKERMNPEE
YERLKGSYIITYEYLSRFKKIPMIMHPLPRVWELTTDVDVLPQAIYFEQAKNGLYMRMAL
IKIILGV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagggaatggatgttatatcagccctccagttctccaggagcgatgtggagaaa
ttaatcaccatagcagaggagttaaggaggcgtgttgaaaacggtgaaaaactagaactg
gccaagggaagaatacttttcacagcgttcttcgagcccagcactagaacccggctgagc
ttccagttcgccatggctaagctagggggcaacgtaattgatctaggacccgaggaggtc
acgagtagagccaagggagagagccctgaggacaccctcaggacagttgatagctacgat
cccgacataatagttgtgagacatagggaacccgggttcgcggctaaggctgctgaaata
tgcagagccccagtggtgaacgccggggatggatacaatgaacacccaacgcaagcccta
cttgatgtctacactatatggaggagcttgggtagaatagatggggtaacaatagggata
atgggggatttaaagtatggtagaaccatctctagcctatcatatatattatccaacttt
agggatgtaacaatatactttatctcaccgcaggcactaagaccccgtgaagaagtatta
aagatacttgaccagaggaggacaaggtacgaactcctcgaaaaaccagacgatgcaatg
gagaaactgaatatcctgtatgtgacaagactacagaaggagagaatgaatccagaggag
tatgagaggcttaaggggagctatattattacatacgagtacctctcacgtttcaagaag
atacccatgataatgcatccactcccaagagtgtgggaactcaccaccgatgtagacgtg
ctaccccaagcgatatactttgaacaagccaagaacggtctctacatgaggatggcattg
ataaaaataatcctcggagtctaa

DBGET integrated database retrieval system