KEGG   Desulfurococcus kamchatkensis: DKAM_0742Help
Entry
DKAM_0742         CDS       T00817                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dka00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dka00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712864..713787
Genome map
AA seq 307 aa AA seqDB search
MYKGMDVISALQFSRSDVEKLITIAEELRRRVENGEKLELAKGRILFTAFFEPSTRTRLS
FQFAMAKLGGNVIDLGPEEVTSRAKGESPEDTLRTVDSYDPDIIVVRHREPGFAAKAAEI
CRAPVVNAGDGYNEHPTQALLDVYTIWRSLGRIDGVTIGIMGDLKYGRTISSLSYILSNF
RDVTIYFISPQALRPREEVLKILDQRRTRYELLEKPDDAMEKLNILYVTRLQKERMNPEE
YERLKGSYIITYEYLSRFKKIPMIMHPLPRVWELTTDVDVLPQAIYFEQAKNGLYMRMAL
IKIILGV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagggaatggatgttatatcagccctccagttctccaggagcgatgtggagaaa
ttaatcaccatagcagaggagttaaggaggcgtgttgaaaacggtgaaaaactagaactg
gccaagggaagaatacttttcacagcgttcttcgagcccagcactagaacccggctgagc
ttccagttcgccatggctaagctagggggcaacgtaattgatctaggacccgaggaggtc
acgagtagagccaagggagagagccctgaggacaccctcaggacagttgatagctacgat
cccgacataatagttgtgagacatagggaacccgggttcgcggctaaggctgctgaaata
tgcagagccccagtggtgaacgccggggatggatacaatgaacacccaacgcaagcccta
cttgatgtctacactatatggaggagcttgggtagaatagatggggtaacaatagggata
atgggggatttaaagtatggtagaaccatctctagcctatcatatatattatccaacttt
agggatgtaacaatatactttatctcaccgcaggcactaagaccccgtgaagaagtatta
aagatacttgaccagaggaggacaaggtacgaactcctcgaaaaaccagacgatgcaatg
gagaaactgaatatcctgtatgtgacaagactacagaaggagagaatgaatccagaggag
tatgagaggcttaaggggagctatattattacatacgagtacctctcacgtttcaagaag
atacccatgataatgcatccactcccaagagtgtgggaactcaccaccgatgtagacgtg
ctaccccaagcgatatactttgaacaagccaagaacggtctctacatgaggatggcattg
ataaaaataatcctcggagtctaa

DBGET integrated database retrieval system