KEGG   Desulfurococcus kamchatkensis: DKAM_0745Help
Entry
DKAM_0745         CDS       T00817                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DKAM_0745
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DKAM_0745
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DKAM_0745
Enzymes [BR:dka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DKAM_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
714981..716267
Genome map
AA seq 428 aa AA seqDB search
MELRSTQTPDILPSYWYNIVPDLPEPLPPMIHPSGEPVKRSELEVLFPRSLVDQEISTQS
RIPIPEAVRETLLMLGRPTPLIRARRLEEALKTNARIFFKYEGVLPTGSHKINTAVAQAY
YNAVESVERVSTETGAGQWGSALSLAGNIYGLKVRVFMVRASYLQKPYRRILMEAYGAEV
YPSPSTKTNTGRKLLAENPDHPGSLGIAISEAIEDVVLSGGRAKYSLGSVLNHVLLHQSV
IGLEAIKQLELLGVERVDYVIGCVGGGSNFAGLSYPFIGYNYNNGEPPVFIAVEPETVPS
MTRGEYRYDYGDTAGLTPLLKMYTLGHDYIPPPIYAGGLRYHGVAPSLSILVKNNIVKPV
AYPQDEVLEAGLVFARTQGILPAPESSHAVKAVIDVALKYRGASEKPTILFNLSGHGLLD
LSAYTRNH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaattaagaagtacccaaacccccgatatactcccatcctactggtataacatagta
cccgatctacctgaaccactacctcccatgattcatcctagcggggagccagttaaaaga
agcgagctggaagtattgttccccaggagtctcgtggaccaggagatcagtacacagagc
cgaatacctatccccgaggctgtcagagagacactacttatgctgggacggcccacgcca
ttgataagggcgagaagactggaagaagctttgaagactaatgcaagaatattctttaaa
tacgagggtgtactccccacgggatcccataaaatcaatacagctgttgcgcaggcatac
tataatgcagttgaaagcgttgaaagggtgtccactgagaccggcgctggtcagtggggc
tcagctctctcattagctggcaacatatacgggttaaaggtaagggtattcatggtaagg
gctagttatcttcagaaaccttatagaaggatcctgatggaggcctatggtgccgaagta
tatcctagtccaagcactaagaccaataccggtagaaagctcttggcagagaaccctgat
caccctggcagcctaggtatagctataagtgaagcaatagaagatgtggtgttgagtggg
ggtagagctaagtatagccttggaagcgtcttaaaccatgtactactgcatcaatctgtg
atagggttagaagccattaagcaattagagttactaggagttgagagagtagactatgtt
attggatgcgttggaggaggctccaacttcgctgggctctcatacccattcataggctac
aactataataatggcgagccaccggtgttcatcgctgttgaaccagaaacagttccctct
atgaccaggggtgagtatagatacgactacggcgatacagccggattaacaccattatta
aaaatgtataccctgggacacgactacatcccaccgccaatatatgcaggtggattaaga
taccatggcgttgctccctcgctaagcatacttgtgaaaaacaatatcgtaaaaccagtt
gcataccctcaggacgaggtattggaggctggactcgtattcgccagaacccagggtatt
cttccagcccctgaaagctctcatgcagtgaaagcagttatagatgtagcgttgaaatac
aggggtgccagcgagaaaccaacaatattattcaatctaagcggacacgggctactggat
ctctcagcgtacacgaggaatcattag

DBGET integrated database retrieval system