KEGG   Desulfurococcus kamchatkensis: DKAM_0882Help
Entry
DKAM_0882         CDS       T00817                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845058..846632)
Genome map
AA seq 524 aa AA seqDB search
MSDGYILSIDQGTTGTRAILFDHEGLPVKMAYREHRQIYPRPGWVEHDPLEIWVNTRYVI
KQVLEGSGVNPGEIKAIGVTNQRETILLWDPETGNPAYNAIVWQDRRTAREVEYLKSKYI
DLIRSKTGLVPDSYFSSTKIWWILDNVPGVREKAVSGRVIAGTIDTWIIWNLTRNSRDVL
TPEKKGAHVTDYSNASRTMLFDIQRIDWDRELLEVQGRIPLEILPLPRPSSDKSLYGYVG
PEIADELFHGYRVPIAGAVGDQQAALFGQAGFEQGDIKCTYGTGNFILVNTGATPVFSKH
GLITTIYYSIEPGKAVYALEGSIFVTGAAIQWLRDGLKIIEVSAEVNPLAESVSDTGGVY
FVPAFTGLGAPYWDQYARGLIIGITRGTERKHLARAVLESIAYLTRDVVEIVELETGSEI
KVLKADGGASRSDFLMQFQADILNTKVVRPMVYETTSLGAAYLAGLAVDYWRSIDELRRY
WRAEKEFIPRISEEIRERLYKGWKEAVKRALGWAREVPWAYGYE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgatggctatattttatccatagatcaaggcactacaggcactagggcaatcctc
ttcgatcatgaaggtctacctgttaaaatggcttacagagaacatagacaaatatatccg
aggcctggctgggtcgagcatgatcccctggagatatgggttaacacgaggtatgttatc
aagcaggttctcgagggtagcggtgttaatccaggtgagattaaggctataggggtcacg
aatcagcgggaaaccatactcctctgggatcccgagacaggtaatcctgcctacaatgct
attgtgtggcaggataggaggactgctagggaggttgaatacttaaagagtaaatacata
gatctcatacgctctaagaccgggcttgtacccgacagctacttctctagcactaagata
tggtggatcctagacaacgtgcctggtgtaagggaaaaggcggtaagcggccgggttata
gccggcaccattgatacgtggattatatggaatctgacaaggaattcaagagatgtgttg
acaccagagaagaagggggctcatgtaaccgattactcaaacgcttctagaaccatgctc
ttcgacatacagaggatcgattgggacagggagctacttgaggtacagggtaggataccc
ttggaaatactcccgcttccacgcccctcaagcgataaaagtctttacggctatgtgggt
ccagagatcgctgatgaattattccatggatacagggtacctatagctggagctgtgggt
gatcagcaggctgcattatttggtcaagctggattcgagcaaggcgatataaagtgtact
tatggcaccgggaacttcatactggttaacactggggctacaccagttttctctaagcat
ggattgatcacaacgatctactatagtattgaacctggtaaagcagtatacgccctagag
ggaagcatatttgtaaccggggcggcgatacaatggctgcgcgatgggttaaagataata
gaggtctcagccgaggtcaacccgcttgcagaatcggtgagcgatacaggtggagtatac
tttgtcccagcgttcaccggcctaggtgcaccctactgggatcaatacgctagaggcctc
ataattggtataacaagaggcaccgagaggaagcacctggcaagagcggtactggaatcc
atagcctacttaaccagggatgttgttgaaatagtggagcttgagacaggttcggagata
aaggtcttaaaggctgatggtggtgcatctagaagcgacttcctgatgcagttccaagcg
gatatattgaatacaaaagtagttaggccaatggtgtatgagactacatcgcttggtgca
gcatatctagcaggactagctgtcgactactggagaagcattgatgaactacgtagatac
tggagggccgagaaagagttcatcccgagaatcagtgaggagataagggaaaggctctac
aaggggtggaaggaggctgttaagagggcgttaggatgggcccgtgaagtaccatgggcc
tatggatatgagtaa

DBGET integrated database retrieval system